SchemaSpy Analysis of ocum - Columns Generated by
SchemaSpy
Generated by SchemaSpy on Tue Apr 23 05:29 EDT 2019
Legend: SourceForge.net
Primary key columns
Columns with indexes
 

ocum contains 2239 columns - click on heading to sort:
Table Column Type Size Nulls Auto Default Comments
exportrulelivelistdtoview accessProtocol varchar 255 Client access protocol. Default value is 'any'. May be comma separated
exportpolicy accessProtocols varchar 255  √  null
event acknowledgedBy varchar 128  √  null
event acknowledgedTimestamp timestamp 19  √  null
datasource acquisitionMessage longtext 2147483647  √  null
datasource acquisitionStatus int 10  √  null
vserverlivelistdtoview activeNisDomainName varchar 255  √  null DERIVED. Domain name of the active NIS server - NULL if none is active.
vserverlivelistdtoview activeNisServers text 65535  √  null DERIVED. NIS servers value of the active NIS server - NULL if none is active.
ontapfaultinfo additionalInfo varchar 1023  √  null
volumedatatransferstatusview additionalInfo varchar 255  √  null A message describing the cause of the failure or additional information about a successful operation.
ldapserver address varchar 255
logicalinterfacelivelistdtoview address varchar 255  √  null
logicalinterfacelivelistdtoview adminStatus varchar 255  √  null
clusternodelivelistdtoview aggrBytesTotal bigint 19  √  null DERIVED. Sum of bytes total (including snapshot) on all aggregates in the Node.
clusternodelivelistdtoview aggrBytesUsed bigint 19  √  null DERIVED. Sum of bytes used (including snapshot) on all aggregates in the Node.
diskaggregaterelationshipaggrcountview aggrCount bigint 19 0
aggregategrowthrateinfo aggregate_id bigint 19
aggregateregressioninfo aggregate_id bigint 19
resourcepoolaggregates aggregate_id bigint 19
halevelmapping aggregateBytesTotal decimal 41  √  null
nodelevelcapacitymapping aggregateBytesTotal bigint 19  √  null DERIVED. Sum of bytes total (including snapshot) on all aggregates in the Node.
halevelmapping aggregateBytesUsed decimal 41  √  null
nodelevelcapacitymapping aggregateBytesUsed bigint 19  √  null DERIVED. Sum of bytes used (including snapshot) on all aggregates in the Node.
storagesummary aggregateCapacity decimal 10,3  √  null
volume aggregateCount int 10  √  1
volumelivelistdtoview aggregateCount int 10  √  1
aggregatelivelistdtoview aggregateDerivedType enum 17  √  null Aggregate Derived Type.
volumelivelistdtoview aggregateHealthStatus int 10  √  null
aggregatecalculationsview aggregateId bigint 19 Locally unique object identifier. ZAPIs: aggr-get-iter.aggr-attributes
aggregatehistorymonth aggregateId bigint 19
aggregatehistoryweek aggregateId bigint 19
aggregatehistoryyear aggregateId bigint 19
volumeaggregatemappingview aggregateId bigint 19  √  null
volumeflexgroupaggregaterelationshipview aggregateId bigint 19  √  null
volumelivelistdtoview aggregateId bigint 19  √  null Locally unique object identifier. ZAPIs: aggr-get-iter.aggr-attributes
deletedvolume aggregateName varchar 255
volumelivelistdtoview aggregateName varchar 255  √  null Textual name
aggregatecapacityutilizationview aggregateType varchar 17
aggregatelivelistdtoview aggregateType varchar 10  √  null
storagesummary aggregateUsedCapacity decimal 10,3  √  null
aggregatecapacityutilizationview aggrId bigint 19 Locally unique object identifier. ZAPIs: aggr-get-iter.aggr-attributes
aggregatecapacityutilizationview aggrName varchar 255 Textual name
volumeaggregatecapacitymappingview aggrSizeAvail decimal 41  √  null
eventontapsystemhealthalertmapping alert_cluster_id bigint 19  √  null
alert_emailaddressrecipients alert_id bigint 19
alert_emailadminrecipients alert_id bigint 19
alert_eventseverities alert_id bigint 19
alerteventtypevalues alert_id bigint 19
alertresourceobjects alert_id bigint 19
eventontapsystemhealthalertmapping alert_id bigint 19
ontapfaultinfo alertId varchar 255
ontapfaultinfo alertingResource varchar 255
ontapfaultinfo alertingResourceName varchar 255  √  null
ontapfaultinfo alertOrigin varchar 255  √  null
aggregatestoragepoollivelistdtoview allocatedCache bigint 19  √  null Capacity provisioned by aggregate from storage pool
storagesummary allocatedLunCapacity decimal 10,3  √  null
aggregatestoragepoollivelistdtoview allocationUnits bigint 19  √  null No of memory units provisioned by aggregate from storage pool
vserverlivelistdtoview allowedProtocols varchar 255  √  null Ordered list of allowed protocols. List of: cifs, nfs, iscsi, and fcp
vserverlivelistdtoview allowedVolumeType varchar 19
eventtype allowsBuiltInAlert bit 1
datasource analysisMessage longtext 2147483647  √  null
datasource analysisStatus int 10  √  null
annotationresourceobject annotation_id bigint 19
annotationresourceobjectlivelistdtoview annotationName varchar 255
annotationresourceobject annotationRule_id bigint 19  √  null
selectioncriterion annotationRuleId bigint 19  √  null
annotationresourceobject annotationType_id bigint 19
annotationmanualresourcemapping annotationTypeId bigint 19
annotationrule annotationTypeId bigint 19
annotationrulelivelistdtoview annotationTypeId bigint 19 0
annotationtypevalueview annotationTypeId bigint 19  √  0
annotationvaluebreakdownlivelistdtoview annotationTypeId bigint 19  √  0
manualannotationbreakdownlivelistdto annotationTypeId bigint 19  √  0
annotationresourceobjectlivelistdtoview annotationTypeName varchar 255
annotationrulelivelistdtoview annotationTypeName varchar 255
annotationtypevalueview annotationTypeName varchar 255  √  null
annotationvaluebreakdownlivelistdtoview annotationTypeName varchar 255  √  null
manualannotationbreakdownlivelistdto annotationTypeName varchar 255  √  null
annotationrulelivelistdtoview annotationValueFullName varchar 511  √  null
annotationvaluebreakdownlivelistdtoview annotationValueFullName varchar 511  √  null
manualannotationbreakdownlivelistdto annotationValueFullName varchar 511  √  null
annotationtypevalueview annotationValueHealthStatus int 10 0
annotationvaluebreakdownlivelistdtoview annotationValueHealthStatus int 10 0
manualannotationbreakdownlivelistdto annotationValueHealthStatus int 10 0
annotationmanualresourcemapping annotationValueId bigint 19
annotationrule annotationValueId bigint 19
annotationrulelivelistdtoview annotationValueId bigint 19 0
annotationtypevalueview annotationValueId bigint 19 0
annotationvaluebreakdownlivelistdtoview annotationValueId bigint 19 0
conditiontable annotationValueId bigint 19  √  null
manualannotationbreakdownlivelistdto annotationValueId bigint 19 0
annotationrulelivelistdtoview annotationValueName varchar 255
annotationtypevalueview annotationValueName varchar 255
annotationvaluebreakdownlivelistdtoview annotationValueName varchar 255
manualannotationbreakdownlivelistdto annotationValueName varchar 255
storagearray arrayId decimal 20  √  null
halevelmapping assignedLunCapacity decimal 65  √  null
lunnodecapacitymapping assignedLunCapacity decimal 41  √  null
nodelevelcapacitymapping assignedLunCapacity decimal 63  √  null
event assignedTimestamp timestamp 19  √  null
event assignedTo varchar 128  √  null
readytaskworkitemqueueentry attributeName varchar 64  √  null
conditiontable attributeType varchar 16
readytaskworkitemqueueentry attributeValue varchar 64  √  null
eventnote author varchar 64
alert_emailadminrecipients authorizationUnit_id bigint 19
authorizationunit authorizationUnitType varchar 255
volumecapacityutilizationview autoGrow int 10 0
volumecapacityview autoGrow int 10 0
aggregate availabilityRiskLevel int 10
cluster availabilityRiskLevel int 10
vserver availabilityRiskLevel int 10
volumecapacityutilizationview availableData decimal 26,2  √  null
aggregatecapacityutilizationview availableDataCapacity decimal 10,2  √  null
volumecapacityutilizationview availableDataCapacity decimal 10,2  √  null
volumecapacityview availableDataCapacity decimal 10,2  √  null
aggregatecapacityutilizationview availableDataCapacityPercentage decimal 25,2  √  null
volumecapacityview availableDataPercentage decimal 26,2  √  null
backupfileinfo backupTotalSize bigint 19 0
disklivelistdtoview bay varchar 255  √  null Disk shelf bay, if it can be determined
backupconsolidateddumpinfo binLogName varchar 255  √  null
backupfileinfo binLogName varchar 255  √  null
qrtz_blob_triggers BLOB_DATA blob 65535  √  null
qrtz_simprop_triggers BOOL_PROP_1 bit 0  √  null
qrtz_simprop_triggers BOOL_PROP_2 bit 0  √  null
bridgestackconnection bridge_id bigint 19
nodebridgeconnection bridge_id bigint 19  √  null
switchbridgeconnection bridge_id bigint 19  √  null
bridgestacklink bridgePort varchar 255  √  null
nodebridgelink bridgePort varchar 255  √  null
switchbridgelink bridgePort varchar 255  √  null
bridgestacklink bridgePortWWPN varchar 255  √  null
nodebridgelink bridgePortWWPN varchar 255  √  null
switchbridgelink bridgePortWWPN varchar 255  √  null
bridgestacklink bridgeStackConnection_id bigint 19  √  null
vserverlivelistdtoview bytesAvail double 22  √  null
vserverlivelistdtoview bytesTotal double 22  √  null
snapmirrortransfer bytesTransferred bigint 19  √  null
vserverlivelistdtoview bytesUsed double 22  √  null
aggregatecapacityutilizationview bytesUsedPerDay double 22  √  0
aggregateregressioninfo bytesUsedPerDay double 22 0
volumecapacityutilizationview bytesUsedPerDay double 22  √  0
volumecapacityview bytesUsedPerDay double 22  √  0
volumeregressioninfo bytesUsedPerDay double 22 0
volumecapacityutilizationview cacheRetentionPriority varchar 255
volumecapacityview cacheRetentionPriority varchar 255
volumelivelistdtoview cacheRetentionPriority varchar 255  √  null raw cache retention priority associated with volumes
volumecapacityutilizationview cachingPolicy varchar 255
volumecapacityview cachingPolicy varchar 255
volumelivelistdtoview cachingPolicy varchar 255  √  null raw cache policy associated with volumes
snapmirrorrelationship calculatedLagErrorThreshold bigint 19  √  null
snapmirrorrelationship calculatedLagWarningThreshold bigint 19  √  null
qrtz_calendars CALENDAR blob 65535
qrtz_calendars CALENDAR_NAME varchar 200
qrtz_triggers CALENDAR_NAME varchar 200  √  null
resourcepool capacityAvailable bigint 19
resourcepoollivelistdtoview capacityAvailable bigint 19
aggregate capacityRiskLevel int 10
cluster capacityRiskLevel int 10
vserver capacityRiskLevel int 10
resourcepool capacityTotal bigint 19
resourcepoollivelistdtoview capacityTotal bigint 19
resourcepool capacityUsed bigint 19
resourcepoollivelistdtoview capacityUsed bigint 19
resourcepoollivelistdtoview capacityUsedPercent decimal 26,4  √  null
eventtype category varchar 60  √  null
inventoryview category enum 28
job category varchar 32
volumejunctionpathhistory changedTime bigint 19
taskstatuschange changeSequence int 10
taskstatuschangeview changeSequence int 10
deferredontapalert changeType int 10
qrtz_scheduler_state CHECKIN_INTERVAL bigint 19
vserverlivelistdtoview cifsEnabled bit 0  √  null CIFS access is supported and enabled
cifssharelivelistdtoview cifsStatus int 10 0
exportrulelivelistdtoview clientMatch varchar 255 Client match specification for Export rule. The clients specified are enforced with this Export rule. The rule with the higher rule index value takes precedence
storageservice clientTag varchar 32  √  null
volumecapacityview cluster varchar 255  √  null
aggregate cluster_id bigint 19  √  null
bridge cluster_id bigint 19
bridgestackconnection cluster_id bigint 19
cifsshare cluster_id bigint 19  √  null
cluster cluster_id bigint 19  √  null
clusternode cluster_id bigint 19  √  null
deferredmccresource cluster_id bigint 19
deferredontapalert cluster_id bigint 19
efficiencypolicy cluster_id bigint 19  √  null
event cluster_id bigint 19  √  null
eventontapsystemhealthalertmapping cluster_id bigint 19  √  null
exportpolicy cluster_id bigint 19  √  null
exportrule cluster_id bigint 19  √  null
fcptarget cluster_id bigint 19  √  null
flashcard cluster_id bigint 19  √  null
initiator cluster_id bigint 19  √  null
initiatorgroup cluster_id bigint 19  √  null
internodeconnection cluster_id bigint 19
interswitchconnection cluster_id bigint 19
logicalinterface cluster_id bigint 19  √  null
lun cluster_id bigint 19  √  null
metroclusterrelationship cluster_id bigint 19  √  null
namespace cluster_id bigint 19  √  null
networkport cluster_id bigint 19  √  null
nodebridgeconnection cluster_id bigint 19
nodestackconnection cluster_id bigint 19
nodeswitchconnection cluster_id bigint 19
objectstore_config cluster_id bigint 19  √  null
ocummonitoringstatus cluster_id bigint 19  √  null
ontapalert cluster_id bigint 19  √  null
ontapems cluster_id bigint 19
ontapfaultinfo cluster_id bigint 19
plex cluster_id bigint 19  √  null
portset cluster_id bigint 19  √  null
qtree cluster_id bigint 19  √  null
snapmirrorrelationship cluster_id bigint 19  √  null
snapshotpolicy cluster_id bigint 19  √  null
storagearrayclusterassociation cluster_id bigint 19
storagearrayportclusterassociation cluster_id bigint 19
storageclass cluster_id bigint 19  √  null
storageshelf cluster_id bigint 19  √  null
switch cluster_id bigint 19
switchbridgeconnection cluster_id bigint 19
targetportalgroup cluster_id bigint 19  √  null
userquota cluster_id bigint 19  √  null
volume cluster_id bigint 19  √  null
volumemovehistory cluster_id bigint 19  √  null
vserver cluster_id bigint 19  √  null
wafldisk cluster_id bigint 19  √  null
annotationvaluebreakdownlivelistdtoview clusterCount decimal 23  √  null
manualannotationbreakdownlivelistdto clusterCount decimal 23  √  null
aggregatecapacityutilizationview clusterFqdn varchar 255  √  null
aggregatelivelistdtoview clusterFqdn varchar 255  √  null
clusternodelivelistdtoview clusterFqdn varchar 255  √  null
nfsexportreportview clusterFqdn varchar 255  √  null
qtreecapacityutilizationreportview clusterFqdn varchar 255  √  null
storagesummary clusterFqdn varchar 255  √  null
volumecapacityutilizationview clusterFqdn varchar 255  √  null
volumelivelistdtoview clusterFqdn varchar 255  √  null
vserverlivelistdtoview clusterFqdn varchar 255  √  null
aggregatelivelistdtoview clusterHealthStatus int 10
clusternodelivelistdtoview clusterHealthStatus int 10
disklivelistdtoview clusterHealthStatus int 10
logicalinterfacelivelistdtoview clusterHealthStatus int 10  √  null
volumelivelistdtoview clusterHealthStatus int 10
vserverlivelistdtoview clusterHealthStatus int 10
aggregatecapacityutilizationview clusterId bigint 19
aggregatelivelistdtoview clusterId bigint 19 Locally unique object identifier. ZAPIs: cluster-identity-get.cluster-identity-info
clusterhistorymonth clusterId bigint 19
clusterhistoryweek clusterId bigint 19
clusterhistoryyear clusterId bigint 19
clusternodelivelistdtoview clusterId bigint 19
datasourcelivelistdtoview clusterId bigint 19  √  null Locally unique object identifier. ZAPIs: cluster-identity-get.cluster-identity-info
diskcapacitymapping clusterId bigint 19
disklivelistdtoview clusterId bigint 19 Locally unique object identifier. ZAPIs: cluster-identity-get.cluster-identity-info
halevelmapping clusterId bigint 19  √  null
logicalinterfacelivelistdtoview clusterId bigint 19
nfsexportreportview clusterId bigint 19 Locally unique object identifier. ZAPIs: cluster-identity-get.cluster-identity-info
nodelevelcapacitymapping clusterId bigint 19
qtreecapacityutilizationreportview clusterId bigint 19 0
storagesummary clusterId bigint 19 Locally unique object identifier. ZAPIs: cluster-identity-get.cluster-identity-info
volumecapacityutilizationview clusterId bigint 19
volumecapacityview clusterId bigint 19
volumelivelistdtoview clusterId bigint 19 Locally unique object identifier. ZAPIs: cluster-identity-get.cluster-identity-info
vserverlivelistdtoview clusterId bigint 19 Locally unique object identifier. ZAPIs: cluster-identity-get.cluster-identity-info
aggregatecapacityutilizationview clusterName varchar 255  √  null
aggregatelivelistdtoview clusterName varchar 255 Textual name
clusternodelivelistdtoview clusterName varchar 255 Textual name
clusterunconfiguredcapacitymapping ClusterName varchar 255 Textual name
deletedvolume clusterName varchar 255
disklivelistdtoview clusterName varchar 255 Textual name
logicalinterfacelivelistdtoview clusterName varchar 255 Textual name
nfsexportreportview clusterName varchar 255 Textual name
qtreecapacityutilizationreportview clusterName varchar 255
storagesummary clusterName varchar 255 Textual name
volumecapacityutilizationview clusterName varchar 255  √  null
volumelivelistdtoview clusterName varchar 255 Textual name
vserverlivelistdtoview clusterName varchar 255 Textual name
event clusterNode_id bigint 19  √  null
externalcache clusterNode_id bigint 19
aggregatelivelistdtoview clusterNodeHealthStatus int 10
volumelivelistdtoview clusterNodeHealthStatus int 10  √  null
aggregatecapacityutilizationview clusternodeId bigint 19
aggregatelivelistdtoview clusterNodeId bigint 19 Locally unique object identifier. ZAPIs: system-node-get-iter.node-details-info, system-get-node-info-iter.system-info
clusternodehistorymonth clusterNodeId bigint 19
clusternodehistoryweek clusterNodeId bigint 19
clusternodehistoryyear clusterNodeId bigint 19
externalcachehistorymonth clusterNodeId bigint 19
externalcachehistoryweek clusterNodeId bigint 19
externalcachehistoryyear clusterNodeId bigint 19
volumelivelistdtoview clusterNodeId bigint 19  √  null Locally unique object identifier. ZAPIs: system-node-get-iter.node-details-info, system-get-node-info-iter.system-info
aggregatecapacityutilizationview clusterNodeName varchar 255  √  null
aggregatelivelistdtoview clusterNodeName varchar 255 Textual name
ontapems clusterNodeName varchar 255  √  null
volumelivelistdtoview clusterNodeName varchar 255  √  null Textual name
volumelivelistdtoview clusterVersion varchar 255  √  null Version of the cluster
volumelivelistdtoview clusterVersionGeneration int 10  √  null First integer of the Data ONTAP version tuple corresponding to the lowest version across the cluster
volumelivelistdtoview clusterVersionMajor int 10  √  null Second integer of the Data ONTAP version tuple corresponding to the lowest version across the cluster
volumelivelistdtoview clusterVersionMinor int 10  √  null Third integer of the Data ONTAP version tuple corresponding to the lowest version across the cluster
inventoryview columns json 0  √  null
clusterlivelistdtoview communicationStatus int 10  √  null
datasource communicationStatus int 10  √  null
job compensationJob_id varchar 64  √  null
job completedTimestamp timestamp 19  √  null
jobreportview completedTimestamp timestamp 19  √  null
task completedTimestamp timestamp 19  √  null
taskreportview completedTimestamp timestamp 19  √  null
volumecapacityutilizationview compression int 10 0
volumecapacityview compression int 10 0
volumecapacityutilizationview compressionSpaceSavings decimal 10,2  √  null
volumecapacityview compressionSpaceSavings decimal 10,2  √  null
volumelivelistdtoview compressionState int 10  √  null
conditiontable conditionGroupId bigint 19
storageserviceconnectionmember connection_id bigint 19
storageserviceconnection connectionType varchar 64
storageservicevserverdestination connectionType varchar 32
vserverassociationlivelistdtoview connectionType varchar 32
volumelivelistdtoview constituentRole varchar 255  √  null
authorizationunit contact varchar 128  √  null
clusterlivelistdtoview contact varchar 255  √  null The contact information for the cluster, ZAPIs: cluster-identity-get cluster-contact
clusternodelivelistdtoview contact varchar 255  √  null The owner of the Node. ZAPI: system-node-get-iter node-owner
storageservice_contacts contact varchar 255
lunlivelistdtoview container varchar 511  √  null
eventtypecategoryclosureassociation container_id bigint 19
aggregatestoragepoollivelistdtoview containerDisksCount bigint 19 The number of disks that are part of the storage pool
disklivelistdtoview containerType varchar 255  √  null
cifssharelivelistdtoview containingObject varchar 256  √  null
cifssharelivelistdtoview containingObjectType varchar 256  √  null
eventnote content varchar 255
storageservicesubscription context varchar 255
job contextObject_id bigint 19  √  null
job contextObject_type varchar 100  √  null
volumerelationshiplivelistdtoview controlPlane varchar 255  √  null The type of the control plane used for the relationship.
ontapfaultinfo correctiveActions varchar 1023  √  null
nodelevelcapacitymapping cpuFirmwareRelease varchar 255  √  null Firmware release number. ZAPI: system-node-get-iter cpu-firware-relsease
inventoryscheduleview createdBy varchar 255
inventoryview createdBy varchar 255
inventoryviewschedule createdBy varchar 255
annotationtype createdByUsername varchar 255  √  null
groups createdByUsername varchar 255
annotationtype createdOnTimestamp timestamp 19  √  CURRENT_TIMESTAMP
groups createdOnTimestamp timestamp 19 CURRENT_TIMESTAMP
eventnote createdTimestamp timestamp 19  √  null
inventoryscheduleview createdTimestamp timestamp 19 0000-00-00 00:00:00.000
inventoryview createdTimestamp timestamp 19  √  null
inventoryviewschedule createdTimestamp timestamp 19 CURRENT_TIMESTAMP(3)
backupconsolidateddumpinfo creationTime timestamp 19  √  null
backupfileinfo creationTime timestamp 19  √  null
qrtz_cron_triggers CRON_EXPRESSION varchar 120
networkport currentLinkStatus varchar 255  √  null
logicalinterfacelivelistdtoview currentPortHealthStatus bigint 19  √  null
logicalinterfacelivelistdtoview currentPortId bigint 19  √  null
logicalinterfacelivelistdtoview currentPortName varchar 511  √  null
fcptarget currentState varchar 255  √  null
aggregatecapacityutilizationview dailyGrowthRate double 19,2  √  null
volumecapacityutilizationview dailyGrowthRate double 19,2  √  null
aggregatecalculationsview dailyGrowthRatePercent double 22  √  null
managedvolumecalculationsview dailyGrowthRatePercent double 22  √  null
volumecapacityview dailyGrowthRatePercentage double 19,2  √  null
managedvolumecalculationsview dailySnapshotGrowthRatePercent double 22  √  null
task data longtext 2147483647  √  null
taskreportview data longtext 2147483647  √  null
annotationofcluster data-priority varchar 255  √  null
annotationofvolume data-priority varchar 255  √  null
annotationofvserver data-priority varchar 255  √  null
backupfileinfo databaseDumpSize bigint 19 0
snapmirrortransfer dataCollectionTimestamp timestamp 19 CURRENT_TIMESTAMP
datapolicy dataPolicyExpression longtext 2147483647
logicalinterfacelivelistdtoview dataProtocols varchar 255  √  null Specifies the list of data protocols configured on the LIF. This can be comma separated. Possible values: nfs, cifs, iscsi, fcp, fc_nvme, fcache, none
cluster dataSource_id int 10
thresholdobjectstocheck dataSource_id bigint 19
inventoryscheduleview day enum 9  √  null
inventoryviewschedule day enum 9  √  null
volumetransferrateweeklyview day varchar 9  √  null
aggregatecapacityutilizationview daysToFull bigint unsigned 20  √  null
volumecapacityutilizationview daysToFull bigint unsigned 20  √  null
volumecapacityview daysToFull bigint unsigned 20  √  null
aggregate daysUntilFull double 22  √  null
managedvolumecalculationsview daysUntilFull double 22  √  null
qrtz_simprop_triggers DEC_PROP_1 decimal 13,4  √  null
qrtz_simprop_triggers DEC_PROP_2 decimal 13,4  √  null
volumelivelistdtoview dedupeEnabled int 10  √  null
volumecapacityutilizationview deduplication int 10 0
volumecapacityview deduplication int 10 0
volumecapacityutilizationview deduplicationSpaceSavings decimal 10,2  √  null
volumecapacityview deduplicationSpaceSavings decimal 10,2  √  null
deferredmccresource deferredTimestamp timestamp 19  √  null
deferredontapalert deferredTimestamp timestamp 19  √  null
ontapfaultinfo deleteTime timestamp 19  √  null
task dependencyOrder int 10
taskreportview dependencyOrder int 10
volumerelationshiplivelistdtoview derivedRelationshipType varchar 255  √  null indicates modes of sync-snap-mirror- full or relaxed along with existing relationship-types
cifssharelivelistdtoview derivedStyle enum 11  √  null DERIVED. Similar to ZAPI based style, but adds in constituent as necessary.
nfsexportlivelistdtoview derivedStyle enum 11  √  null DERIVED. Similar to ZAPI based style, but adds in constituent as necessary.
alert description varchar 1024  √  null
annotationtype description varchar 1024
customeventtype description varchar 255
groupaction description varchar 1024  √  null
groupactionlivelistdtoview description varchar 1024  √  null
grouplivelistdtoview description varchar 1024  √  null
groups description varchar 1024  √  null
qrtz_job_details DESCRIPTION varchar 250  √  null
qrtz_triggers DESCRIPTION varchar 250  √  null
resourcepool description longtext 2147483647  √  null
resourcepoollivelistdtoview description longtext 2147483647  √  null
script description varchar 1024  √  null
scriptlivelistdtoview description varchar 1024  √  null
serviceworkflow description varchar 1024
storageservice description varchar 255  √  null
subscribedems description varchar 4096  √  null
task description longtext 2147483647  √  null
taskreportview description longtext 2147483647  √  null
volumerelationshiplivelistdtoview destinationAggregateHealthStatus int 10  √  null
volumerelationshiplivelistdtoview destinationAggregateId bigint 19  √  null Locally unique object identifier. ZAPIs: aggr-get-iter.aggr-attributes
volumerelationshiplivelistdtoview destinationAggregateName varchar 255  √  null Textual name
volumedatatransferstatusview destinationClusterFqdn varchar 255  √  null
volumerelationshiplivelistdtoview destinationClusterFqdn varchar 255  √  null
svmrelationshiplivelistdtoview destinationClusterHealthStatus int 10
volumerelationshiplivelistdtoview destinationClusterHealthStatus int 10
svmrelationshiplivelistdtoview destinationClusterId bigint 19 Locally unique object identifier. ZAPIs: cluster-identity-get.cluster-identity-info
volumedatatransferstatusview destinationClusterId bigint 19 Locally unique object identifier. ZAPIs: cluster-identity-get.cluster-identity-info
volumerelationshiplivelistdtoview destinationClusterId bigint 19 Locally unique object identifier. ZAPIs: cluster-identity-get.cluster-identity-info
vserverassociationlivelistdtoview destinationClusterId bigint 19 Locally unique object identifier. ZAPIs: cluster-identity-get.cluster-identity-info
svmrelationshiplivelistdtoview destinationClusterName varchar 255 Textual name
volumedatatransferstatusview destinationClusterName varchar 255 Textual name
volumerelationshiplivelistdtoview destinationClusterName varchar 255 Textual name
vserverassociationlivelistdtoview destinationClusterName varchar 255 Textual name
volumerelationshiplivelistdtoview destinationClusterNodeHealthStatus int 10  √  null
volumerelationshiplivelistdtoview destinationClusterNodeId bigint 19  √  null Locally unique object identifier. ZAPIs: system-node-get-iter.node-details-info, system-get-node-info-iter.system-info
volumerelationshiplivelistdtoview destinationClusterNodeName varchar 255  √  null Textual name
volumerelationshiplivelistdtoview destinationClusterVersion varchar 255  √  null Version of the cluster
volumerelationshiplivelistdtoview destinationClusterVersionGeneration int 10  √  null First integer of the Data ONTAP version tuple corresponding to the lowest version across the cluster
volumerelationshiplivelistdtoview destinationClusterVersionMajor int 10  √  null Second integer of the Data ONTAP version tuple corresponding to the lowest version across the cluster
volumerelationshiplivelistdtoview destinationClusterVersionMinor int 10  √  null Third integer of the Data ONTAP version tuple corresponding to the lowest version across the cluster
storageserviceconnection destinationNode_id bigint 19
volumerelationshiplivelistdtoview destinationNodeCount int 10  √  1
storageserviceconnectionmember destinationNodeMember_id bigint 19
volumerelationshiplivelistdtoview destinationPath text 65535  √  null
volumerelationshiplivelistdtoview destinationVolumeHealthStatus int 10
volumedatatransferstatusview destinationVolumeId bigint 19 Locally unique object identifier. ZAPIs: volume-get-iter.volume-attributes
volumerelationshiplivelistdtoview destinationVolumeId bigint 19 Locally unique object identifier. ZAPIs: volume-get-iter.volume-attributes
volumedatatransferstatusview destinationVolumeName varchar 255 Textual name
volumerelationshiplivelistdtoview destinationVolumeName varchar 255 Textual name
volumerelationshiplivelistdtoview destinationVolumeState varchar 255  √  null
volumerelationshiplivelistdtoview destinationVolumeStyle enum 11  √  null DERIVED. Similar to ZAPI based style, but adds in constituent as necessary.
volumerelationshiplivelistdtoview destinationVolumeType varchar 255  √  null
storageservicevserverdestination destinationVserver_id bigint 19
svmrelationshiplivelistdtoview destinationVserverHealthStatus int 10
volumerelationshiplivelistdtoview destinationVserverHealthStatus int 10
svmrelationshiplivelistdtoview destinationVserverId bigint 19 Locally unique object identifier. ZAPIs: vserver-get-iter.vserver-info
volumedatatransferstatusview destinationVserverId bigint 19 Locally unique object identifier. ZAPIs: vserver-get-iter.vserver-info
volumerelationshiplivelistdtoview destinationVserverId bigint 19 Locally unique object identifier. ZAPIs: vserver-get-iter.vserver-info
vserverassociationlivelistdtoview destinationVserverId bigint 19 Locally unique object identifier. ZAPIs: vserver-get-iter.vserver-info
svmrelationshiplivelistdtoview destinationVserverName varchar 255 Textual name
volumedatatransferstatusview destinationVserverName varchar 255 Textual name
volumerelationshiplivelistdtoview destinationVserverName varchar 255 Textual name
vserverassociationlivelistdtoview destinationVserverName varchar 255 Textual name
volumelivelistdtoview dfBytesActualSize bigint 19  √  null Size of volume in bytes. Includes WAFL reserve and snapshot reserve
aggregatelivelistdtoview dfBytesAvail bigint 19  √  null Number of bytes still available in the referenced file system. ZAPIs: aggr-get-iter aggr-space-attributes size-available
volumelivelistdtoview dfBytesAvail bigint 19  √  null
volumecalculationsview dfBytesAvailablePercent decimal 27,4  √  null
volumelivelistdtoview dfBytesAvailablePercent decimal 27,4  √  null
aggregatecalculationsview dfBytesAvailPercent decimal 26,4  √  null
aggregatelivelistdtoview dfBytesAvailPercent decimal 26,4  √  null
volumelivelistdtoview dfBytesLogicalSpaceUsedPercent int 10  √  null Total used logical space available in the volume in terms of percentage
aggregatelivelistdtoview dfBytesTotal bigint 19  √  null Total size (in bytes) of the referenced file system . If the referenced file system is restricted or offline, a value of 0 is returned
volumelivelistdtoview dfBytesTotal bigint 19  √  null Usable size of volume in bytes for data (not including WAFL reserve or snapshot reserve)
aggregatelivelistdtoview dfBytesTotalCommitted bigint 19  √  null A derived measure of the committed capacity of all Volumes on this Aggregate. "Committed" here is defined as the total capacity a volume might consume if entirely full.
aggregatelivelistdtoview dfBytesUsed bigint 19  √  null Number of bytes used in the referenced file system. If the referenced file system is restricted or offline, a value of 0 is returned
volumelivelistdtoview dfBytesUsed bigint 19  √  null Used size of the volume in bytes
aggregatecalculationsview dfBytesUsedPercent decimal 26,4  √  null
aggregatelivelistdtoview dfBytesUsedPercent decimal 26,4  √  null
volumecalculationsview dfBytesUsedPercent decimal 26,4  √  null
volumelivelistdtoview dfBytesUsedPercent decimal 26,4  √  null
volumehistorymonth dfKBytesCloneSpaceSavingsSum bigint 19 0
volumehistoryweek dfKBytesCloneSpaceSavingsSum bigint 19 0
volumehistoryyear dfKBytesCloneSpaceSavingsSum bigint 19 0
aggregatehistorymonth dfKBytesCompressionSpaceSavingsSum bigint 19 0
aggregatehistoryweek dfKBytesCompressionSpaceSavingsSum bigint 19 0
aggregatehistoryyear dfKBytesCompressionSpaceSavingsSum bigint 19 0
infinitevolhistorymonth dfKBytesCompressionSpaceSavingsSum bigint 19 0
infinitevolhistoryweek dfKBytesCompressionSpaceSavingsSum bigint 19 0
infinitevolhistoryyear dfKBytesCompressionSpaceSavingsSum bigint 19 0
volumehistorymonth dfKBytesCompressionSpaceSavingsSum bigint 19 0
volumehistoryweek dfKBytesCompressionSpaceSavingsSum bigint 19 0
volumehistoryyear dfKBytesCompressionSpaceSavingsSum bigint 19 0
aggregatehistorymonth dfKBytesDedupeSpaceSavingsSum bigint 19 0
aggregatehistoryweek dfKBytesDedupeSpaceSavingsSum bigint 19 0
aggregatehistoryyear dfKBytesDedupeSpaceSavingsSum bigint 19 0
infinitevolhistorymonth dfKBytesDedupeSpaceSavingsSum bigint 19 0
infinitevolhistoryweek dfKBytesDedupeSpaceSavingsSum bigint 19 0
infinitevolhistoryyear dfKBytesDedupeSpaceSavingsSum bigint 19 0
volumehistorymonth dfKBytesDedupeSpaceSavingsSum bigint 19 0
volumehistoryweek dfKBytesDedupeSpaceSavingsSum bigint 19 0
volumehistoryyear dfKBytesDedupeSpaceSavingsSum bigint 19 0
aggregatehistorymonth dfKBytesTotal bigint 19 0
aggregatehistoryweek dfKBytesTotal bigint 19 0
aggregatehistoryyear dfKBytesTotal bigint 19 0
infinitevolhistorymonth dfKBytesTotal bigint 19 0
infinitevolhistoryweek dfKBytesTotal bigint 19 0
infinitevolhistoryyear dfKBytesTotal bigint 19 0
volumehistorymonth dfKBytesTotal bigint 19 0
volumehistoryweek dfKBytesTotal bigint 19 0
volumehistoryyear dfKBytesTotal bigint 19 0
aggregatehistorymonth dfKBytesTotalCommittedSum bigint 19 0
aggregatehistoryweek dfKBytesTotalCommittedSum bigint 19 0
aggregatehistoryyear dfKBytesTotalCommittedSum bigint 19 0
aggregatehistorymonth dfKBytesUsedSum bigint 19 0
aggregatehistoryweek dfKBytesUsedSum bigint 19 0
aggregatehistoryyear dfKBytesUsedSum bigint 19 0
infinitevolhistorymonth dfKBytesUsedSum bigint 19 0
infinitevolhistoryweek dfKBytesUsedSum bigint 19 0
infinitevolhistoryyear dfKBytesUsedSum bigint 19 0
volumehistorymonth dfKBytesUsedSum bigint 19 0
volumehistoryweek dfKBytesUsedSum bigint 19 0
volumehistoryyear dfKBytesUsedSum bigint 19 0
volume dfSnapshotBytesAvail double 22  √  null
volume dfSnapshotBytesUsed double 22  √  null
volumecalculationsview dfSnapshotBytesUsedPercent double 22  √  null
aggregatehistorymonth dfSnapshotKBytesTotal bigint 19 0
aggregatehistoryweek dfSnapshotKBytesTotal bigint 19 0
aggregatehistoryyear dfSnapshotKBytesTotal bigint 19 0
infinitevolhistorymonth dfSnapshotKBytesTotal bigint 19 0
infinitevolhistoryweek dfSnapshotKBytesTotal bigint 19 0
infinitevolhistoryyear dfSnapshotKBytesTotal bigint 19 0
volumehistorymonth dfSnapshotKBytesTotal bigint 19 0
volumehistoryweek dfSnapshotKBytesTotal bigint 19 0
volumehistoryyear dfSnapshotKBytesTotal bigint 19 0
aggregatehistorymonth dfSnapshotKBytesUsedSum bigint 19 0
aggregatehistoryweek dfSnapshotKBytesUsedSum bigint 19 0
aggregatehistoryyear dfSnapshotKBytesUsedSum bigint 19 0
infinitevolhistorymonth dfSnapshotKBytesUsedSum bigint 19 0
infinitevolhistoryweek dfSnapshotKBytesUsedSum bigint 19 0
infinitevolhistoryyear dfSnapshotKBytesUsedSum bigint 19 0
volumehistorymonth dfSnapshotKBytesUsedSum bigint 19 0
volumehistoryweek dfSnapshotKBytesUsedSum bigint 19 0
volumehistoryyear dfSnapshotKBytesUsedSum bigint 19 0
clusterlivelistdtoview diagnosisStatus varchar 255  √  null Overall system health as determined by diagnosis framework - ZAPI raw value
alert disabled bit 1
clusternodelivelistdtoview diskCount bigint 19  √  null
qtreecapacityutilizationreportview diskHardLimit bigint 19  √  null
qtreelivelistdtoview diskHardLimit bigint 19  √  null
userquotalivelistdtoview diskHardLimit bigint 19  √  null
qtreecapacityutilizationreportview diskHardLimitUnlimited tinyint 3  √  null
qtreelivelistdtoview diskHardLimitUnlimited bit 0  √  1 True if there is no disk limit
userquotalivelistdtoview diskHardLimitUnlimited bit 0 1 True if there is no disk limit
diskaggregaterelationshipaggrcountview diskId bigint 19  √  null
storagearraylunpath diskName varchar 255  √  null
clusternodelivelistdtoview diskShelveCount bigint 19  √  null
qtreecapacityutilizationreportview diskSoftLimit bigint 19  √  null
qtreelivelistdtoview diskSoftLimit bigint 19  √  null
userquotalivelistdtoview diskSoftLimit bigint 19  √  null
qtreecapacityutilizationreportview diskSoftLimitUnlimited tinyint 3  √  null
qtreelivelistdtoview diskSoftLimitUnlimited bit 0  √  1 True if there is no soft disk limit
userquotalivelistdtoview diskSoftLimitUnlimited bit 0 1 True if there is no soft disk limit
qtreecapacityutilizationreportview diskThreshold bigint 19  √  null
qtreelivelistdtoview diskThreshold bigint 19  √  null
userquotalivelistdtoview diskThreshold bigint 19  √  null
qtreecapacityutilizationreportview diskThresholdUnlimited tinyint 3  √  null
qtreelivelistdtoview diskThresholdUnlimited bit 0  √  1 True if there is no threshold limit
userquotalivelistdtoview diskThresholdUnlimited bit 0 1 True if there is no threshold limit
qtreecapacityutilizationreportview diskTotal bigint 19  √  null
qtreelivelistdtoview diskTotal bigint 19  √  null
userquotalivelistdtoview diskTotal bigint 19  √  null
disklivelistdtoview diskType varchar 255  √  null
qtreecapacityutilizationreportview diskUsed bigint 19  √  null
qtreelivelistdtoview diskUsed bigint 19  √  null
userquotalivelistdtoview diskUsed bigint 19  √  null
qtreecapacityutilizationreportview diskUsedPercent decimal 30,4  √  null
qtreelivelistdtoview diskUsedPercent decimal 30,4  √  null
userquotalivelistdtoview diskUsedPercent decimal 26,4  √  null
vserverlivelistdtoview dnsDomainNames varchar 255  √  null List of DNS domains. The first domain is the one that the Vserver belongs to
vserverlivelistdtoview dnsEnabled bit 0  √  null True if DNS enabled
vserverlivelistdtoview dnsServers varchar 255  √  null IPv4 addresses of name servers. Multiple values will be sorted comma separated
switch domainId int 10  √  null
optionchainvalue domainObject_id bigint 19
optionchainvalue domainObject_type varchar 100
clusternodedowneventsview downTimestamp timestamp 19  √  null
clusternodelivelistdtoview downTimestamp timestamp 19  √  null
datasourcelivelistdtoview durationSinceLastFailure bigint 19  √  null
datasourcelivelistdtoview durationSinceLastSuccess bigint 19  √  null
clusterlivelistdtoview durationSinceLastUpdate bigint 19  √  null
disklivelistdtoview effectiveType varchar 255  √  null
alert_emailaddressrecipients emailAddress varchar 255
alert_script_audit emailAddress varchar 255  √  null
authorizationunit emailAddress varchar 255  √  null
userquota emailAddress varchar 255  √  null
userquota emailGeneratedTime timestamp 19  √  null
ontapems emsCorrectiveAction varchar 4096  √  null
ontapems emsEmissionTimestamp timestamp 19 0000-00-00 00:00:00
ontapems emsEvent varchar 4096
ontapems emsGenericTriggerCondition varchar 4096  √  null
ontapems emsMessageName varchar 255
ontapems emsMessageSeverity varchar 255
event encodedArguments longtext 2147483647  √  null
qrtz_triggers END_TIME bigint 19  √  null
maintenance_window endTime bigint 19
volumetransferrateweeklyview endTime varchar 24  √  null
qrtz_fired_triggers ENTRY_ID varchar 95
clusternodelivelistdtoview ethernetPortCount bigint 19  √  null
clienteventdetails event_id bigint 19
eventnote event_id bigint 19
eventontapsystemhealthalertmapping event_id bigint 19
trap event_id bigint 19  √  null
eventontapsystemhealthalertmapping event_source_id bigint 19
eventtypevalue eventDisplayName varchar 255
alert_script_audit eventId bigint 19
clusternodedowneventsview eventName varchar 255
eventontapsystemhealthalertmapping eventResolvedTimestamp timestamp 19  √  null
alert eventSeverity varchar 16  √  null
alert_eventseverities eventSeverity varchar 16
event eventTimestamp timestamp 19  √  null
eventtypecategoryclosureassociation eventType_id bigint 19
eventtypesourcetypes eventType_id bigint 19
alert eventTypeRegex varchar 255  √  null
alerteventtypevalues eventTypeValue_id bigint 19
eventontapsystemhealthalertmapping eventTypeValueName varchar 255
clienteventdetails eventUrl varchar 360  √  null
alert excludeFilter longtext 2147483647  √  null
snapshotexpirerecord expirationRequestTimestamp timestamp 19 CURRENT_TIMESTAMP
cifssharelivelistdtoview exportPolicyHealthStatus int 10
exportrulelivelistdtoview exportPolicyHealthStatus int 10
nfsexportlivelistdtoview exportPolicyHealthStatus int 10
cifssharelivelistdtoview exportPolicyId bigint 19 Locally unique object identifier. ZAPIs: export-policy-get-iter.export-policy-info
exportrulelivelistdtoview exportPolicyId bigint 19 Locally unique object identifier. ZAPIs: export-policy-get-iter.export-policy-info
nfsexportlivelistdtoview exportPolicyId bigint 19 Locally unique object identifier. ZAPIs: export-policy-get-iter.export-policy-info
nfsexportreportview exportPolicyId bigint 19 Locally unique object identifier. ZAPIs: export-policy-get-iter.export-policy-info
cifssharelivelistdtoview exportPolicyName varchar 255  √  null
exportrulelivelistdtoview exportPolicyName varchar 255  √  null Name of the policy
nfsexportlivelistdtoview exportPolicyName varchar 255  √  null Name of the policy
nfsexportreportview exportPolicyName varchar 255  √  null Name of the policy
ruletemplate expression longtext 2147483647
externalcache externalCacheHitsPerSecond bigint 19  √  null
externalcachehistorymonth externalCacheHitsPerSecondSum bigint 19 0
externalcachehistoryweek externalCacheHitsPerSecondSum bigint 19 0
externalcachehistoryyear externalCacheHitsPerSecondSum bigint 19 0
switch fabricName varchar 255  √  null
logicalinterfacelivelistdtoview failoverGroup varchar 255  √  null The cluster-wide unique name of the failover group.
logicalinterfacelivelistdtoview failoverPolicy varchar 255  √  null
task failureReason longtext 2147483647  √  null
taskreportview failureReason longtext 2147483647  √  null
clusternodelivelistdtoview fcoePortCount bigint 19  √  null
vserverlivelistdtoview fcpEnabled bit 0  √  null FCP access is supported and enabled
clusternodelivelistdtoview fcPortCount bigint 19  √  null
snapshotmetadata fieldName varchar 255
storageservicesubscription_metadatafields fieldName varchar 255
volumesnapshot_metadatafields fieldName varchar 255
snapshotmetadata fieldValue varchar 16384
storageservicesubscription_metadatafields fieldValue longtext 2147483647
volumesnapshot_metadatafields fieldValue longtext 2147483647
qtreecapacityutilizationreportview fileHardLimit bigint 19  √  null
qtreelivelistdtoview fileHardLimit bigint 19  √  null
userquotalivelistdtoview fileHardLimit bigint 19  √  null Maximum number of files allowed for the quota target
qtreecapacityutilizationreportview fileHardLimitUnlimited tinyint 3  √  null
qtreelivelistdtoview fileHardLimitUnlimited bit 0  √  1 True if there is no file limit
userquotalivelistdtoview fileHardLimitUnlimited bit 0 1 True if there is no file limit
backupconsolidateddumpinfo fileName varchar 255
backupfileinfo fileName varchar 255
backupconsolidateddumpinfo fileSize bigint 19  √  null
qtreecapacityutilizationreportview fileSoftLimit bigint 19  √  null
qtreelivelistdtoview fileSoftLimit bigint 19  √  null
userquotalivelistdtoview fileSoftLimit bigint 19  √  null Soft file limit, in number of files, for the quota target
qtreecapacityutilizationreportview fileSoftLimitUnlimited tinyint 3  √  null
qtreelivelistdtoview fileSoftLimitUnlimited bit 0  √  1 True if there is no soft file limit
userquotalivelistdtoview fileSoftLimitUnlimited bit 0 1 True if there is no soft file limit
qtreecapacityutilizationreportview fileUsed bigint 19  √  null
qtreelivelistdtoview fileUsed bigint 19  √  null Current number of files used by the quota target
userquotalivelistdtoview fileUsed bigint 19  √  null Current number of files used by the quota target
qtreecapacityutilizationreportview fileUsedPercent decimal 26,4  √  null
qtreelivelistdtoview fileUsedPercent decimal 26,4  √  null
userquotalivelistdtoview fileUsedPercent decimal 26,4  √  null
qtreecapacityutilizationreportview fileUsedUnlimited tinyint 3  √  null
qtreelivelistdtoview fileUsedUnlimited bit 0  √  1 True if there is no limit for file used
userquotalivelistdtoview fileUsedUnlimited bit 0 1 True if there is no limit for file used
inventoryview filters json 0  √  null
qrtz_fired_triggers FIRED_TIME bigint 19
bridge firmware varchar 255  √  null
disklivelistdtoview firmwareRevision varchar 255  √  null Firmware revision of disk. The format of the firmware revision will vary depending on the type of disk and its vendor
storagearray firmwareRevision varchar 128  √  null
clusternodelivelistdtoview firmwareVersion varchar 255  √  null Firmware release number. ZAPI: system-node-get-iter cpu-firware-relsease
switch firmwareVersion varchar 255  √  null
internodeconnection firstNode_id bigint 19  √  null
internodelink firstNodePort varchar 255  √  null
internodelink firstNodePortWWPN varchar 255  √  null
interswitchconnection firstSwitch_id bigint 19  √  null
interswitchlink firstSwitchPort varchar 255  √  null
interswitchlink firstSwitchPortWWPN varchar 255  √  null
clusternodelivelistdtoview flashCardCount bigint 19  √  null
clusternodelivelistdtoview flashCardSize decimal 44  √  null
volumeflexgroupaggregaterelationshipview flexgroupId bigint 19  √  null Volume ObjId of the flexgroup volume which this flexgroup constituent belongs to
inventoryscheduleview format enum 4
inventoryviewschedule format enum 4
cluster fqdn varchar 255  √  null
clusterlivelistdtoview fqdn varchar 255  √  null
routinggrouproutesview gateway varchar 255  √  null The IP address and subnet mask of destination
volumeaggregatecapacitymappingview GROUP_CONCAT(volumeAggregateMapping.aggregateid) text 65535  √  null
groupactionargument groupActionArgumentRawValue varchar 255  √  null
groupactionargument groupActionId bigint 19  √  null
groupaction groupActionType varchar 255
groupactionlivelistdtoview groupActionType varchar 255
groupactionargument groupActionTypeParameter varchar 255
groupaction groupId bigint 19  √  null
groupactionlivelistdtoview groupId bigint 19  √  null
groupmembership groupId bigint 19
groupmembershiprule groupId bigint 19
groupmembershiprulelivelistdtoview groupId bigint 19
groupmembership groupMembershipRuleId bigint 19
selectioncriterion groupMembershipRuleId bigint 19  √  null
groupactionlivelistdtoview groupName varchar 255  √  null
groupmembershiprulelivelistdtoview groupName varchar 255  √  null
aggregatecapacityutilizationview haPair varchar 255  √  null
storagesummary haPair varchar 255  √  null
halevelmapping haPairId bigint 19 Locally unique object identifier. ZAPIs: cf-get-iter.storage-failover-info
clusternodelivelistdtoview haPairName varchar 255  √  null
halevelmapping haPairName varchar 511  √  null
hapairview haPairName varchar 255  √  null
backupfileinfo hasIncrementalDump bit 1 b'1'
aggregatelivelistdtoview hasLocalRoot bit 0  √  null Whether the aggregate contains the local root volume. ZAPIs: aggr-get-iter has-local-root.
aggregatelivelistdtoview hasPartnerRoot bit 0  √  null Whether the aggregate contains the partner's root volume. ZAPIs: aggr-get-iter has-partner-root.
cluster hasSingleNode bit 1
clusternodehighavailabilitystateview haState varchar 14
clusternodelivelistdtoview haState varchar 14  √ 
clusternodehighavailabilitystateview haStateErrorReason text 65535  √  null
clusternodelivelistdtoview haStateErrorReason text 65535  √  null
clusternodehighavailabilitystateview haStatus varchar 21
clusternodelivelistdtoview haStatus varchar 21  √ 
aggregate healthStatus int 10
aggregatelivelistdtoview healthStatus int 10
aggregatestoragepoollivelistdtoview healthStatus int 10
annotationtypevalueview healthStatus int 10 0
annotationvaluebreakdownlivelistdtoview healthStatus int 10 0
bridge healthStatus int 10
bridgestackconnection healthStatus int 10
cluster healthStatus int 10
clusterlivelistdtoview healthStatus int 10
clusternode healthStatus int 10
clusternodelivelistdtoview healthStatus int 10
datasource healthStatus int 10
disklivelistdtoview healthStatus int 10
efficiencypolicy healthStatus int 10
exportpolicy healthStatus int 10
fcptarget healthStatus int 10
flashcard healthStatus int 10
initiatorgroup healthStatus int 10
internodeconnection healthStatus int 10
interswitchconnection healthStatus int 10
logicalinterface healthStatus int 10
logicalinterfacelivelistdtoview healthStatus int 10  √  null
lun healthStatus int 10
lunlivelistdtoview healthStatus int 10
managementstation healthStatus int 10
manualannotationbreakdownlivelistdto healthStatus int 10 0
metroclusterrelationship healthStatus int 10
namespace healthStatus int 10
networkport healthStatus int 10
nfsexportlivelistdtoview healthStatus int 10
nodebridgeconnection healthStatus int 10
nodestackconnection healthStatus int 10
nodeswitchconnection healthStatus int 10
objectstore_config healthStatus int 10
portlivelistdtoview healthStatus int 10 0
portset healthStatus int 10
qtree healthStatus int 10
qtreecapacityutilizationreportview healthStatus int 10  √  null
qtreelivelistdtoview healthStatus int 10
serviceworkflow healthStatus int 10
snapmirrorrelationship healthStatus int 10
snapshotpolicy healthStatus int 10
storageclass healthStatus int 10
storageservice healthStatus int 10
storageshelf healthStatus int 10
svmrelationshiplivelistdtoview healthStatus int 10
switch healthStatus int 10
switchbridgeconnection healthStatus int 10
targetportalgroup healthStatus int 10
userquota healthStatus int 10
userquotalivelistdtoview healthStatus int 10
volume healthStatus int 10
volumelivelistdtoview healthStatus int 10
volumerelationshiplivelistdtoview healthStatus int 10
vserver healthStatus int 10
vserverlivelistdtoview healthStatus int 10
wafldisk healthStatus int 10
externalcache hitPercentage int 10  √  null
externalcachehistorymonth hitPercentageSum bigint 19 0
externalcachehistoryweek hitPercentageSum bigint 19 0
externalcachehistoryyear hitPercentageSum bigint 19 0
logicalinterfacelivelistdtoview homePortHealthStatus bigint 19  √  null
logicalinterfacelivelistdtoview homePortId bigint 19  √  null
logicalinterfacelivelistdtoview homePortName varchar 511  √  null
aggregate id bigint 19
aggregategrowthrateinfo id bigint 19
aggregatelivelistdtoview id bigint 19 Locally unique object identifier. ZAPIs: aggr-get-iter.aggr-attributes
aggregateregressioninfo id bigint 19
aggregatestoragepoollivelistdtoview Id bigint 19 Locally unique object identifier. ZAPIs: aggr-get-iter.aggr-attributes
alert id bigint 19
alert_script_audit id bigint 19
annotation id bigint 19  √ 
annotationofcluster id bigint 19
annotationofvolume id bigint 19
annotationofvserver id bigint 19
annotationrule id bigint 19  √ 
annotationrulelivelistdtoview id bigint 19 0
annotationtype id bigint 19  √ 
authorizationunit id bigint 19
backupconsolidateddumpinfo id bigint 19
backupfileinfo id bigint 19
bridge id bigint 19
bridgestackconnection id bigint 19
bridgestacklink id bigint 19
cifsshare id bigint 19
cifssharelivelistdtoview id bigint 19 Locally unique object identifier. ZAPIs: cifs-share-get-iter.cifs-share
clienteventdetails id bigint 19
cluster id bigint 19
clusterlivelistdtoview id bigint 19 Locally unique object identifier. ZAPIs: cluster-identity-get.cluster-identity-info
clusternode id bigint 19
clusternodelivelistdtoview id bigint 19 Locally unique object identifier. ZAPIs: system-node-get-iter.node-details-info, system-get-node-info-iter.system-info
conditiongroup id bigint 19  √ 
conditiontable id bigint 19  √ 
customer_usage id bigint 19
customeventtype id bigint 19
customeventtypevalue id bigint 19
datapolicy id bigint 19
datasource id int 10
datasourcelivelistdtoview id int 10
deferredmccresource id bigint 19
deferredontapalert id bigint 19
deletedvolume id bigint 19
diskaggregaterelationship id bigint 19  √ 
disklivelistdtoview id bigint 19 Locally unique object identifier. ZAPIs: storage-disk-get-iter.storage-disk-info
efficiencypolicy id bigint 19
event id bigint 19
eventnote id bigint 19
eventontapsystemhealthalertmapping id bigint 19
eventtype id bigint 19
eventtypecategorycontainer id bigint 19
eventtypevalue id bigint 19
exportpolicy id bigint 19
exportrule id bigint 19
exportrulelivelistdtoview id bigint 19 Locally unique object identifier. ZAPIs: export-rule-get-iter.export-rule-info
externalcache id bigint 19
favorite id bigint 19
fcptarget id bigint 19
flashcard id bigint 19
groupaction id bigint 19  √ 
groupactionargument id bigint 19  √ 
groupactionlivelistdtoview id bigint 19 0
grouplivelistdtoview id bigint 19 0
groupmembershiprule id bigint 19  √ 
groupmembershiprulelivelistdtoview id bigint 19 0
groups id bigint 19  √ 
igrouplivelistdtoview id bigint 19 Locally unique object identifier. ZAPIs: igroup-get-iter.initiator-group-info
initiator id bigint 19
initiatordtoviewlist id bigint 19  √  null Locally unique object identifier. ZAPIs: igroup-get-iter.initiator-group-info.initiators.initiator-info
initiatorgroup id bigint 19
internodeconnection id bigint 19
internodelink id bigint 19
interswitchconnection id bigint 19
interswitchlink id bigint 19
inventoryscheduleview id bigint 19 0
inventoryview id bigint 19  √ 
inventoryviewreport id bigint 19
inventoryviewschedule id bigint 19  √ 
job id varchar 64
jobreportview id varchar 64
ldapserver id bigint 19
license id bigint 19
logicalinterface id bigint 19
logicalinterfacelivelistdtoview id bigint 19 Locally unique object identifier. ZAPIs: net-interface-get-iter.net-interface-info
lun id bigint 19
lunlivelistdtoview Id bigint 19 Locally unique object identifier. ZAPIs: lun-get-iter.lun-info
maintenance_window id bigint 19
maintenance_window_object_mapping id bigint 19
managementstation id bigint 19
metroclusterrelationship id bigint 19
namespace id bigint 19
networkport id bigint 19
nfsexportlivelistdtoview id bigint 19  √  null
nodebridgeconnection id bigint 19
nodebridgelink id bigint 19
nodestackconnection id bigint 19
nodestacklink id bigint 19
nodeswitchconnection id bigint 19
nodeswitchlink id bigint 19
objectstore_config id bigint 19
ocummonitoringstatus id bigint 19  √ 
ontapalert id bigint 19
ontapems id bigint 19
ontapemsparameter id bigint 19
ontapfaultinfo id bigint 19
optionchainvalue id bigint 19
persistentproperty id bigint 19
plex id bigint 19  √ 
portlivelistdtoview id bigint 19 0
portset id bigint 19
qtree id bigint 19
qtreelivelistdtoview id bigint 19 Locally unique object identifier. ZAPIs: qtree-list-iter.qtree-info
readytaskworkitemqueueentry id bigint 19
resourcepool id bigint 19
resourcepoollivelistdtoview id bigint 19
role id bigint 19
routinggrouproutesview id bigint 19
ruletemplate id bigint 19
script id bigint 19
scriptlivelistdtoview id bigint 19
selectioncriterion id bigint 19  √ 
serviceworkflow id bigint 19
snapmirrorrelationship id bigint 19
snapmirrortransfer id bigint 19
snapshotexpirerecord id bigint 19
snapshotmetadata id bigint 19
snapshotpolicy id bigint 19
storagearray id bigint 19
storagearrayclusterassociation id bigint 19
storagearraylunpath id bigint 19
storagearrayport id bigint 19
storageclass id bigint 19
storageservice id bigint 19
storageserviceconnection id bigint 19
storageserviceconnectionmember id bigint 19
storageservicenode id bigint 19
storageservicenodemember id bigint 19
storageservicerootmemberinfo id bigint 19
storageservicesubscription id bigint 19
storageservicevserverdestination id bigint 19
storageshelf id bigint 19
subscribedems id bigint 19
svmrelationshiplivelistdtoview id bigint 19 Locally unique object identifier. ZAPIs: snapmirror-get-iter.snapmirror-info
switch id bigint 19
switchbridgeconnection id bigint 19
switchbridgelink id bigint 19
targetportalgroup id bigint 19
task id varchar 64
taskmessage id varchar 64
taskreportview id varchar 64
taskretry id varchar 64
taskstatuschange id varchar 64
taskstatuschangeview id varchar 64
trap id bigint 19
trapvarbinding id bigint 19
userquota id bigint 19
userquotalivelistdtoview id bigint 19 Locally unique object identifier. ZAPIs: quota-report-iter.quota
volume id bigint 19
volumegrowthrateinfo id bigint 19
volumejunctionpathhistory id bigint 19
volumelivelistdtoview id bigint 19 Locally unique object identifier. ZAPIs: volume-get-iter.volume-attributes
volumemovehistory id bigint 19
volumeregressioninfo id bigint 19
volumerelationshiplivelistdtoview id bigint 19 Locally unique object identifier. ZAPIs: snapmirror-get-iter.snapmirror-info
vserver id bigint 19
vserverassociationlivelistdtoview id bigint 19
vserverlivelistdtoview id bigint 19 Locally unique object identifier. ZAPIs: vserver-get-iter.vserver-info
wafldisk id bigint 19
storagearrayclusterassociation idOnCluster decimal 20  √  null
eventtype ignoresDuplicates bit 1
initiatorcountperigroupdtoview igroupId bigint 19
lifcountperigrouplistdtoview igroupId bigint 19 Locally unique object identifier. ZAPIs: igroup-get-iter.initiator-group-info
luncountperigrouplistdtoview igroupId bigint 19  √  null
initiatordtoviewlist igroupMappedInitiatorCount bigint 19 0
igrouplivelistdtoview igroupName varchar 255 Textual name
igrouplivelistdtoview igroupType varchar 255  √  null Raw value of type of initiators in this group.
event impactArea varchar 60  √  null
eventtype impactArea varchar 60  √  null
disklivelistdtoview impactedAggregateHealthStatus bigint 19  √  null
disklivelistdtoview impactedAggregateId bigint 19  √  null
disklivelistdtoview impactedAggregateName varchar 255  √  null
disklivelistdtoview impactedAggregatesCount bigint 19  √  null
eventtypevalue impactLevel int 10
alert includeFilter longtext 2147483647  √  null
ontapfaultinfo indicationTime timestamp 19  √  null
storageservicenodemember initialClusterName varchar 255
storageserviceconnectionmember initialRelationshipId bigint 19  √  null
storageservicenodemember initialVolumeFullName varchar 512
storageservicenodemember initialVolumeId bigint 19  √  null
storageservicenodemember initialVolumeInstanceUuid varchar 255
storageservicenodemember initialVolumeName varchar 255
storageservicenodemember initialVolumeResourceKey varchar 512  √  null
storageservicenodemember initialVserverName varchar 255
initiatorcountperigroupdtoview initiatorMappedIgroup bigint 19 0
igrouplivelistdtoview initiatorMappedIgroupCount bigint 19  √  0
initiatordtoviewlist initiatorName varchar 255 Textual name
initiatordtoviewlist initiatorType varchar 5
volumecapacityutilizationview inodeUtilization decimal 25,2  √  null
volumecapacityview inodeUtilizationPercentage decimal 25,2  √  null
thresholdobjectstocheck insertionTimestamp timestamp 19 CURRENT_TIMESTAMP
qrtz_fired_triggers INSTANCE_NAME varchar 200
qrtz_scheduler_state INSTANCE_NAME varchar 200
qrtz_simprop_triggers INT_PROP_1 int 10  √  null
qrtz_simprop_triggers INT_PROP_2 int 10  √  null
eventtypevalue internalName varchar 100
taskreportview internalStatus varchar 32
internodelink InterNodeConnection_id bigint 19  √  null
interswitchlink interSwitchConnection_id bigint 19  √  null
switchinterswitchrelationship interSwitchConnection_id bigint 19
inventoryscheduleview intervalUnit enum 7
inventoryviewschedule intervalUnit enum 7
bridge ipAddress varchar 255  √  null
switch ipAddress varchar 255  √  null
qrtz_job_details IS_DURABLE varchar 1
qrtz_fired_triggers is_nonconcurrent bit 0  √  null
qrtz_job_details is_nonconcurrent bit 0  √  null
qrtz_fired_triggers is_update_data bit 0  √  null
qrtz_job_details is_update_data bit 0  √  null
ontapfaultinfo isActiveAlert bit 1  √  b'1'
clusternodelivelistdtoview isAllFlashOptimized bit 0  √  null Is this node configured to only support SSD drives. If true, no HDDs are allowed on this node.
halevelmapping isAllFlashOptimized bit 0  √  null Is this node configured to only support SSD drives. If true, no HDDs are allowed on this node.
nodelevelcapacitymapping isAllFlashOptimized bit 0  √  null Is this node configured to only support SSD drives. If true, no HDDs are allowed on this node.
eventtype isAutoReset bit 1
bridge isBeingMonitored bit 1  √  null
cluster isBridgeStretchConfig bit 1  √  b'1'
annotation isBuiltIn bit 1
annotationtype isBuiltIn bit 1
aggregatelivelistdtoview isCftPrecommit int 10  √  null
volumelivelistdtoview isCftPrecommit int 10  √  null
event isChecked bit 1  √  null
event isContinuous bit 1 b'1'
vserverlivelistdtoview iscsiEnabled bit 0  √  null iSCSI access is supported and enabled
userquota isEdited bit 1 b'0'
ocummonitoringstatus isEmsConfigured bit 1  √  b'0'
subscribedems isEnabled bit 1 b'1'
eventtypevalue isEventGenerationEnabled bit 1 b'1'
cluster isHardwareSystem bit 1  √  b'1'
svmrelationshiplivelistdtoview isHealthy bit 0  √  null False if the last manual or scheduled update failed or was aborted, or if the last scheduled update was delayed. Otherwise true
volumerelationshiplivelistdtoview isHealthy int 10  √  null
aggregatelivelistdtoview isHybridEnabled bit 0  √  null If true, aggregate is eligible to contain both SSD and non-SSD RAID groups
cifssharelivelistdtoview isJunctionPathActive bit 0  √  null If mounted volume is accessible
nfsexportlivelistdtoview isJunctionPathActive bit 0  √  null If mounted volume is accessible
nfsexportreportview isJunctionPathActive bit 0  √  null If mounted volume is accessible
storageserviceconnection isLagErrorEnabled bit 1  √  null
storageserviceconnection isLagWarningEnabled bit 1  √  null
disklivelistdtoview isLocalAttach int 10  √  null
nodestackconnection isLocalAttach bit 1  √  null
lunnodecapacitymapping isLunMapped int 10  √  null
lunlivelistdtoview isMapped bit 0  √  null Is the LUN mapped to any initiator?
storageservice isMarkedForDeletion bit 1
snapmirrortransfer isMissingData bit 1  √  null
eventtype isMultiCurrent bit 1
storageserviceconnection isNetworkCompressionEnabled bit 1 b'0'
nfsexportlivelistdtoview isNfsEnabled int 10  √  null
lunlivelistdtoview isOnline bit 0  √  null Is LUN online?
plex isOnline bit 1  √  b'0'
flexvolcalculationsview isPrimary int 10 0
storagearraylunpath isPrimaryPath bit 1
qtreecapacityutilizationreportview isQuotaSet bigint 19 0
qtreelivelistdtoview isQuotaSet int 10 0
vserverlivelistdtoview isRepository bit 0  √  null Specifies if this Vserver is a repository Vserver
backupfileinfo isScheduled bit 1  √  b'1'
clusternodehighavailabilitystateview isSfoPairInterconnectUp int 10  √  null
clusternodelivelistdtoview isSfoPairInterconnectUp int 10  √  null
volume isSnapMirrorDestination bit 1  √  b'0'
lunlivelistdtoview isThinProvision int 10  √  null
storageservicenode isThinProvision bit 1 b'1'
volumelivelistdtoview isThinProvisioned int 10  √  null
clusternodelivelistdtoview isUp bit 0  √  null The RDB health of the node. True means the node is in quorum. ZAPI: system-node-get-iter is-node-healthy
snapmirrorrelationship isVersionFlexibleReplicationEnabled enum 15 none
cifssharelivelistdtoview isVserverRoot bit 0  √  null Is the volume the root of a vserver
nfsexportlivelistdtoview isVserverRoot bit 0  √  null Is the volume the root of a vserver
nfsexportreportview isVserverRoot bit 0  √  null Is the volume the root of a vserver
job job longblob 2147483647  √  null
qrtz_job_details JOB_CLASS_NAME varchar 250
qrtz_job_details JOB_DATA blob 65535  √  null
qrtz_triggers JOB_DATA blob 65535  √  null
qrtz_fired_triggers JOB_GROUP varchar 200  √  null
qrtz_job_details JOB_GROUP varchar 200
qrtz_triggers JOB_GROUP varchar 200
task job_id varchar 64
taskretry job_id varchar 64
qrtz_fired_triggers JOB_NAME varchar 200  √  null
qrtz_job_details JOB_NAME varchar 200
qrtz_triggers JOB_NAME varchar 200
taskreportview jobId varchar 64
job jobType varchar 64
jobreportview jobType varchar 64
cifssharelivelistdtoview junctionPath varchar 255  √  null
deletedvolume junctionPath varchar 512  √  null
nfsexportlivelistdtoview junctionPath varchar 511  √  null
nfsexportreportview junctionPath varchar 511  √  null
volumejunctionpathhistory junctionPath varchar 255  √  null
volumelivelistdtoview junctionPath varchar 255  √  null
vserverhistorymonth kBytesTotalSum bigint 19
vserverhistoryweek kBytesTotalSum bigint 19
vserverhistoryyear kBytesTotalSum bigint 19
vserverhistorymonth kBytesUsedSum bigint 19
vserverhistoryweek kBytesUsedSum bigint 19
vserverhistoryyear kBytesUsedSum bigint 19
snapmirrortransfer lagDuration bigint 19  √  null
svmrelationshiplivelistdtoview lagDuration bigint 19  √  null
volumerelationshiplivelistdtoview lagDuration bigint 19  √  null
snapmirrortransfer lagErrorThreshold bigint 19  √  null
storageserviceconnection lagErrorThreshold bigint 19  √  null
snapmirrorrelationship lagStatus enum 7  √  null
svmrelationshiplivelistdtoview lagStatus enum 7  √  null
volumerelationshiplivelistdtoview lagStatus varchar 14  √  null
snapmirrortransfer lagWarningThreshold bigint 19  √  null
storageserviceconnection lagWarningThreshold bigint 19  √  null
qrtz_scheduler_state LAST_CHECKIN_TIME bigint 19
snapshotexpirerecord lastDeleteAttemptTimestamp timestamp 19  √  null
wafldisk lastFailedTime bigint 19 0
diskaggregaterelationship lastKnownAggregateId bigint 19
diskaggregaterelationship lastKnownDiskId bigint 19
wafldisk lastKnownEffectiveInterfaceTypeRaw varchar 255  √  null
cifsshare lastKnownQtreeId bigint 19  √  null
wafldisk lastKnownRaidGroupId bigint 19  √  null
cifsshare lastKnownVolumeId bigint 19  √  null
event lastObservedTime bigint 19  √  null
datasource lastOperationFailureTime timestamp 19  √  null
datasourcelivelistdtoview lastOperationFailureTime timestamp 19  √  null
datasource lastOperationSuccessTime timestamp 19  √  null
datasourcelivelistdtoview lastOperationSuccessTime timestamp 19  √  null
aggregategrowthrateinfo lastSampleTime timestamp 19  √  null
aggregateregressioninfo lastSampleTime timestamp 19  √  null
volumegrowthrateinfo lastSampleTime timestamp 19  √  null
volumeregressioninfo lastSampleTime timestamp 19  √  null
snapmirrorrelationship lastSuccessfulTransferDuration bigint 19  √  null
snapmirrorrelationship lastSuccessfulTransferEndTimestamp timestamp 19  √  null
snapmirrorrelationship lastSuccessfulTransferSize bigint 19  √  null
svmrelationshiplivelistdtoview lastSuccessfulUpdateTime bigint 19  √  null
volumerelationshiplivelistdtoview lastSuccessfulUpdateTime bigint 19  √  null
aggregate lastSync bigint 19
cifsshare lastSync bigint 19
cluster lastSync bigint 19
clusternode lastSync bigint 19
efficiencypolicy lastSync bigint 19
exportpolicy lastSync bigint 19
exportrule lastSync bigint 19
fcptarget lastSync bigint 19
flashcard lastSync bigint 19
initiator lastSync bigint 19
initiatorgroup lastSync bigint 19
logicalinterface lastSync bigint 19
lun lastSync bigint 19
namespace lastSync bigint 19
networkport lastSync bigint 19
objectstore_config lastSync bigint 19
ontapalert lastSync bigint 19
ontapfaultinfo lastSync bigint 19  √  null
plex lastSync bigint 19
portset lastSync bigint 19
qtree lastSync bigint 19
snapmirrorrelationship lastSync bigint 19
snapshotpolicy lastSync bigint 19
storageclass lastSync bigint 19
storageshelf lastSync bigint 19
targetportalgroup lastSync bigint 19
userquota lastSync bigint 19
volume lastSync bigint 19
volumemovehistory lastSync bigint 19
vserver lastSync bigint 19
wafldisk lastSync bigint 19
svmrelationshiplivelistdtoview lastTransferDuration bigint 19  √  null
volumerelationshiplivelistdtoview lastTransferDuration bigint 19  √  null
volumerelationshiplivelistdtoview lastTransferEndTime timestamp 19  √  null
snapmirrortransfer lastTransferEndTimestamp timestamp 19  √  null
svmrelationshiplivelistdtoview lastTransferSize bigint 19  √  null The total number of bytes transferred as part of the last transfer. ZAPI: snapmirror-info.last-transfer-size
volumerelationshiplivelistdtoview lastTransferSize bigint 19  √  null
clusterlivelistdtoview lastUpdateTime bigint 19  √  null
volumelivelistdtoview lastVolumeMoveState varchar 40  √  null
vserverlivelistdtoview ldapEnabled bit 0  √  null If true, the corresponding Lightweight Directory Access Protocol (LDAP) configuration is enabled for this Vserver.
annotation legacyName varchar 255  √  null
annotationtype legacyName varchar 255  √  null
taskmessage level varchar 16
license licenseData varchar 10000
portlivelistdtoview lifCount bigint 19  √  null
portsetnamesperlogicalinterfacedtoview lifId bigint 19 Locally unique object identifier. ZAPIs: net-interface-get-iter.net-interface-info
igrouplivelistdtoview lifMappedIgroupCount varchar 278  √  null
lifcountperigrouplistdtoview LIFMappingCount bigint 19 0
bridgestacklink linkStatus int 10  √  null
internodelink linkStatus int 10  √  null
interswitchlink linkStatus int 10  √  null
nodebridgelink linkStatus int 10  √  null
nodestacklink linkStatus int 10  √  null
nodeswitchlink linkStatus int 10  √  null
switchbridgelink linkStatus int 10  √  null
storagearraylunpath loadPercent float 12  √  null
volumelivelistdtoview localSnapshotPolicyName varchar 255  √  null A human readable string describing the name of the snapshot scheduling policy.
clusterlivelistdtoview location varchar 255  √  null The location of the cluster, ZAPIs: cluster-identity-get cluster-location
clusternodelivelistdtoview location varchar 255  √  null Location of the node.
qrtz_locks LOCK_NAME varchar 40
volumelivelistdtoview logicalSpaceReportingStatus varchar 13
qrtz_simprop_triggers LONG_PROP_1 bigint 19  √  null
qrtz_simprop_triggers LONG_PROP_2 bigint 19  √  null
lunmapidperigroupdtoview lunId bigint 19
storagearraylunpath lunIops decimal 20  √  null
luncountperigrouplistdtoview LUNMappedIgroup bigint 19 0
igrouplivelistdtoview lunMappedIgroupCount bigint 19  √  0
storagearraylunpath lunNumber int 10  √  null
lunlivelistdtoview lunSize bigint 19  √  null Size of the LUN in bytes
event maintenance bit 1 b'0'
maintenance_window_object_mapping maintenanceWindowId bigint 19
storagearray managementAddress varchar 64  √  null
igrouplivelistdtoview mappedLunIdentifier text 65535  √  null
luncountperigrouplistdtoview mappedLunIdentifier text 65535  √  null
lunlivelistdtoview mappedLunIdentifier text 65535  √  null
lunmapidperigroupdtoview mappedLunIdentifier text 65535  √  null
eventtype maxDuplicatesToIgnore int 10  √  null
vserverlivelistdtoview maximumVolumes int 10  √  null Maximum number of volumes that can be created on the Vserver
volumelivelistmaxvolumemovejobview maxStartTime timestamp 19  √  null The date and time in cluster timezone when the volume move started. ZAPI: volume-move-get-iter volume-move-info start-timestamp
storageserviceconnection maxTransferRate bigint 19  √  null
volumelivelistmaxvolumemovejobview maxUpdateTime bigint 19  √  null
aggregateregressioninfo meanBytesData double 22 0
volumeregressioninfo meanBytesData double 22 0
aggregategrowthrateinfo meanGrowthRate double 22 0
volumegrowthrateinfo meanGrowthRate double 22 0
aggregateregressioninfo meanSnapshotData double 22 0
volumeregressioninfo meanSnapshotData double 22 0
aggregateregressioninfo meanTime double 22 0
volumeregressioninfo meanTime double 22 0
taskmessage message longtext 2147483647
subscribedems messageName varchar 255
vserver metadataVolumeId bigint 19  √  null
vserver metadataVolumeLastUpdateTime timestamp 19  √  null
ocummonitoringstatus metroClusterMonitorStatus int 10 0
trapvarbinding mibSymbol varchar 128  √  null
aggregatelivelistdtoview mirrorStatusRaw varchar 255  √  null
qrtz_triggers MISFIRE_INSTR smallint 5  √  null
bridge model varchar 255  √  null
clusternodelivelistdtoview model varchar 255  √  null Hardware model of this node.
disklivelistdtoview model varchar 255  √  null Disk model string
halevelmapping model varchar 255  √  null Hardware model of this node.
nodelevelcapacitymapping model varchar 255  √  null Hardware model of this node.
storagearray model varchar 255  √  null
storagesummary model varchar 255  √  null Hardware model of this node.
switch model varchar 255  √  null
volumemovehistory moveState varchar 40  √  null
clusternode mtAutomaticUso bit 1  √  b'1'
aggregatelivelistdtoview name varchar 255 Textual name
aggregatestoragepoollivelistdtoview name varchar 255 Textual name
alert name varchar 255
annotation name varchar 255
annotationrule name varchar 255
annotationrulelivelistdtoview name varchar 255
annotationtype name varchar 255
authorizationunit name varchar 255
cifssharelivelistdtoview name varchar 255  √  null
clusterlivelistdtoview name varchar 255 Textual name
clusternodelivelistdtoview name varchar 255 Textual name
customer_usage name varchar 255  √  null
datasourcelivelistdtoview name varchar 255  √  null
disklivelistdtoview name varchar 255 Textual name
eventtype name varchar 128
eventtypecategorycontainer name varchar 255
groupaction name varchar 255
groupactionlivelistdtoview name varchar 255
grouplivelistdtoview name varchar 255
groupmembershiprule name varchar 255
groupmembershiprulelivelistdtoview name varchar 255
groups name varchar 255
inventoryscheduleview name varchar 255
inventoryview name varchar 255
inventoryviewschedule name varchar 255
job name varchar 280
jobreportview name varchar 280
logicalinterfacelivelistdtoview name varchar 255 Textual name
lun name varchar 255
lunlivelistdtoview name varchar 255  √  null
namespace name varchar 255
nfsexportlivelistdtoview name text 65535  √  null
portlivelistdtoview name varchar 255  √  null
qtreelivelistdtoview name varchar 255  √  null
resourcepoollivelistdtoview name varchar 255
ruletemplate name varchar 255
script name varchar 255
scriptlivelistdtoview name varchar 255
snapmirrorrelationship name varchar 2048
storageshelf name varchar 40  √  null
svmrelationshiplivelistdtoview name varchar 2048
task name varchar 2048
taskreportview name varchar 2048
userquota name varchar 1024  √  null
volumelivelistdtoview name varchar 255 Textual name
volumerelationshiplivelistdtoview name varchar 2048
vserverlivelistdtoview name varchar 255 Textual name
storagearrayclusterassociation nameOnCluster varchar 64  √  null
vserverlivelistdtoview nameServerSwitch varchar 255  √  null Name Server switch configuration details for the Vserver.Multiple values will be ordered comma separated
volume namespaceConstituent_id bigint 19  √  null
qrtz_triggers NEXT_FIRE_TIME bigint 19  √  null
hibernate_sequences next_val int 10
vserverlivelistdtoview nfsEnabled bit 0  √  null NFS access is supported and enabled
cifssharelivelistdtoview nfsEquivalent int 10 0
nfsexportlivelistdtoview nfsExportStatus varchar 7
nfsexportreportview nfsStatus varchar 6
vserverlivelistdtoview nisEnabled bit 0  √  null Specifies whether the NIS domain configuration is active or inactive
hapairview node1Id bigint 19 The objid of node1 in this ha_pair.
hapairview node2Id bigint 19 The objid of node2 in this ha_pair.
clusternodededicatesparecapacityview node_id bigint 19  √  null
clusternodedowneventsview node_id bigint 19
clusternodehighavailabilitystateview node_id bigint 19 Locally unique object identifier. ZAPIs: system-node-get-iter.node-details-info, system-get-node-info-iter.system-info
clusternoderawsparecapacityview node_id bigint 19 Locally unique object identifier. ZAPIs: system-node-get-iter.node-details-info, system-get-node-info-iter.system-info
clusternoderawsparesharedcachecapacityview node_id bigint 19
clusternoderawspareshareddatacapacityview node_id bigint 19  √  null
nodebridgeconnection node_id bigint 19  √  null
nodestackconnection node_id bigint 19
nodeswitchconnection node_id bigint 19  √  null
storageservicenodemember node_id bigint 19
nodebridgelink nodeBridgeConnection_id bigint 19  √  null
volume nodeCount int 10  √  1
volumelivelistdtoview nodeCount int 10  √  1
portlivelistdtoview nodeHealthStatus int 10  √  null
halevelmapping nodeId bigint 19  √  null Locally unique object identifier. ZAPIs: system-node-get-iter.node-details-info, system-get-node-info-iter.system-info
lunnodecapacitymapping nodeId bigint 19  √  null
nodelevelcapacitymapping nodeId bigint 19 Locally unique object identifier. ZAPIs: system-node-get-iter.node-details-info, system-get-node-info-iter.system-info
portlivelistdtoview nodeId bigint 19  √  null
volumenodecapacitymapping nodeId bigint 19  √  null
nodelevelcapacitymapping nodeName varchar 255 Textual name
portlivelistdtoview nodeName varchar 255  √  null
storageservicenode nodeName varchar 255
nodebridgelink nodePort varchar 255  √  null
nodestacklink nodePort varchar 255  √  null
nodeswitchlink nodePort varchar 255  √  null
nodebridgelink nodePortWWPN varchar 255  √  null
nodestacklink nodePortWWPN varchar 255  √  null
nodeswitchlink nodePortWWPN varchar 255  √  null
nodestacklink nodeStackConnection_id bigint 19  √  null
nodeswitchlink nodeSwitchConnection_id bigint 19  √  null
grouplivelistdtoview numberOfActions bigint 19  √  null
annotationrulelivelistdtoview numberOfAnnotatedObjects bigint 19  √  null
grouplivelistdtoview numberOfClusters bigint 19  √  null
volumecapacityutilizationview numberOfInodesUsed bigint 19  √  null Number of user-visible files (inodes) used. This field is valid only when the volume is online. ZAPIs: volume-get-iter volume-inode-attributes files-used
volumecapacityview numberOfInodesUsed bigint 19  √  null Number of user-visible files (inodes) used. This field is valid only when the volume is online. ZAPIs: volume-get-iter volume-inode-attributes files-used
groupmembershiprulelivelistdtoview numberOfMatchingObjects bigint 19  √  null
grouplivelistdtoview numberOfMembershipRules bigint 19  √  null
clusterlivelistdtoview numberOfNodes bigint 19  √  null
grouplivelistdtoview numberOfSVMs bigint 19  √  null
grouplivelistdtoview numberOfVolumes bigint 19  √  null
aggregategrowthrateinfo numRates int 10 0
volumegrowthrateinfo numRates int 10 0
aggregateregressioninfo numSamples bigint 19 0
volumeregressioninfo numSamples bigint 19 0
inventoryview object varchar 255
taskobjectinteraction object_fullName varchar 2000
thresholdobjectstocheck object_fullName varchar 2000
taskobjectinteraction object_id bigint 19
thresholdobjectstocheck object_id bigint 19
taskobjectinteraction object_resourceKey varchar 512
thresholdobjectstocheck object_ResourceKey varchar 512
taskobjectinteraction object_type varchar 100
thresholdobjectstocheck object_type varchar 100
disklivelistdtoview objectId bigint 19 Locally unique object identifier. ZAPIs: storage-disk-get-iter.storage-disk-info
portlivelistdtoview objectId bigint 19 0
svmrelationshiplivelistdtoview objectId bigint 19 Locally unique object identifier. ZAPIs: snapmirror-get-iter.snapmirror-info
volumelivelistdtoview objectId bigint 19 Locally unique object identifier. ZAPIs: volume-get-iter.volume-attributes
volumerelationshiplivelistdtoview objectId bigint 19 Locally unique object identifier. ZAPIs: snapmirror-get-iter.snapmirror-info
bridge objectName varchar 255
bridgestackconnection objectName varchar 255
datasource objectName varchar 255
internodeconnection objectName varchar 255
interswitchconnection objectName varchar 255
managementstation objectName varchar 255
metroclusterrelationship objectName varchar 255
nodebridgeconnection objectName varchar 255
nodestackconnection objectName varchar 255
nodeswitchconnection objectName varchar 255
resourcepool objectName varchar 255
role objectName varchar 255
serviceworkflow objectName varchar 255
storageservice objectName varchar 255
switch objectName varchar 255
switchbridgeconnection objectName varchar 255
datasource objectResourceKey varchar 512 1
aggregatecapacityutilizationview objectStoreName varchar 255  √  null
inventoryscheduleview objectType varchar 255
clusterunconfiguredcapacitymapping objid bigint 19 Locally unique object identifier. ZAPIs: cluster-identity-get.cluster-identity-info
hapairview objid bigint 19 Locally unique object identifier. ZAPIs: cf-get-iter.storage-failover-info
eventtype objType varchar 100
eventtypevalue objType varchar 100
aggregategrowthrateinfo objVersion int 10
aggregateregressioninfo objVersion int 10
alert objVersion int 10
authorizationunit objVersion int 10
backupconsolidateddumpinfo objVersion int 10 0
backupfileinfo objVersion int 10 0
bridge objVersion int 10
bridgestackconnection objVersion int 10
bridgestacklink objVersion int 10
clienteventdetails objVersion int 10
datapolicy objVersion int 10
datasource objVersion int 10
deletedvolume objVersion int 10
event objVersion int 10
eventnote objVersion int 10
eventtype objVersion int 10
eventtypecategorycontainer objVersion int 10
eventtypevalue objVersion int 10
externalcache objVersion int 10
internodeconnection objVersion int 10
internodelink objVersion int 10
interswitchconnection objVersion int 10
interswitchlink objVersion int 10
ldapserver objVersion int 10
managementstation objVersion int 10
metroclusterrelationship objVersion int 10
nodebridgeconnection objVersion int 10
nodebridgelink objVersion int 10
nodestackconnection objVersion int 10
nodestacklink objVersion int 10
nodeswitchconnection objVersion int 10
nodeswitchlink objVersion int 10
ontapems objVersion int 10
ontapemsparameter objVersion int 10
ontapfaultinfo objVersion int 10
optionchainvalue objVersion int 10
persistentproperty objVersion int 10
readytaskworkitemqueueentry objVersion int 10
resourcepool objVersion int 10
role objVersion int 10
ruletemplate objVersion int 10
serviceworkflow objVersion int 10
snapmirrortransfer objVersion int 10
snapshotexpirerecord objVersion int 10
snapshotmetadata objVersion int 10
storagearray objVersion int 10
storagearrayclusterassociation objVersion int 10
storagearraylunpath objVersion int 10
storagearrayport objVersion int 10
storageservice objVersion int 10
storageserviceconnection objVersion int 10
storageserviceconnectionmember objVersion int 10
storageservicenode objVersion int 10
storageservicenodemember objVersion int 10
storageservicerootmemberinfo objVersion int 10
storageservicesubscription objVersion int 10
storageservicevserverdestination objVersion int 10
switch objVersion int 10
switchbridgeconnection objVersion int 10
switchbridgelink objVersion int 10
trap objVersion int 10
trapvarbinding objVersion int 10
volumegrowthrateinfo objVersion int 10
volumejunctionpathhistory objVersion int 10
volumeregressioninfo objVersion int 10
event obsoleteCause varchar 60  √  null
event obsoleteCauseEncodedArguments longtext 2147483647  √  null
event obsoleteCauseEvent_id bigint 19  √  null
event obsoleteCauseValue_id bigint 19  √  null
event obsoleteTimestamp timestamp 19  √  null
trapvarbinding oid varchar 128
deferredontapalert ontapAlert_id bigint 19
ontapemsparameter ontapEms_id bigint 19  √  null
halevelmapping ontapVersion varchar 1024  √  null
nodelevelcapacitymapping ontapVersion varchar 1024  √  null
storagesummary ontapVersion varchar 1024  √  null
conditiontable operandId bigint 19
datasource operation int 10  √  1
datasourcelivelistdtoview operation int 10  √  1
datasource operationEndTime timestamp 19  √  null
datasourcelivelistdtoview operationEndTime timestamp 19  √  null
volumedatatransferstatusview operationResult int 10 0
datasource operationStartTime timestamp 19  √  null
datasourcelivelistdtoview operationStartTime timestamp 19  √  null
datasource operationState int 10  √  0
datasourcelivelistdtoview operationState int 10  √  0
volumedatatransferstatusview operationType varchar 255
conditiontable operator varchar 16
optionchainvalue optionName varchar 255
optionchainvalue optionValue varchar 255
igrouplivelistdtoview osType varchar 255  √  null OS type of the initiator group
lunlivelistdtoview osType varchar 255  √  null The OS type of the LUN
eventtypevalue outboundTrapOID int 10  √  null
snapmirrorrelationship overallStatus enum 7  √  null
svmrelationshiplivelistdtoview overallStatus enum 7  √  null
volumerelationshiplivelistdtoview overallStatus enum 7  √  null
aggregatecapacityutilizationview overCommittedCapacityPercentage decimal 26,2  √  null
infinitevolhistorymonth overwriteReserveSpaceAvailSum bigint 19 0
infinitevolhistoryweek overwriteReserveSpaceAvailSum bigint 19 0
infinitevolhistoryyear overwriteReserveSpaceAvailSum bigint 19 0
volumehistorymonth overwriteReserveSpaceAvailSum bigint 19 0
volumehistoryweek overwriteReserveSpaceAvailSum bigint 19 0
volumehistoryyear overwriteReserveSpaceAvailSum bigint 19 0
storageservice owner varchar 64  √  null
logicalinterface owner_id bigint 19
logicalinterface owner_type varchar 100
logicalinterfacelivelistdtoview ownerHealthStatus bigint 19  √  null
logicalinterfacelivelistdtoview ownerId bigint 19  √  null
logicalinterfacelivelistdtoview ownerName varchar 255  √  null
disklivelistdtoview ownerNodeClusterId bigint 19  √  null
disklivelistdtoview ownerNodeHealthStatus int 10  √  null
disklivelistdtoview ownerNodeId bigint 19  √  null Locally unique object identifier. ZAPIs: system-node-get-iter.node-details-info, system-get-node-info-iter.system-info
disklivelistdtoview ownerNodeName varchar 255  √  null Textual name
authorizationunit pagerAddress varchar 255  √  null
ontapemsparameter paramName varchar 255  √  null
ontapemsparameter paramValue varchar 255  √  null
eventtype parentCategory_id bigint 19  √  null
eventtypecategorycontainer parentCategory_id bigint 19  √  null
halevelmapping partnerNodeId bigint 19  √  null
nodelevelcapacitymapping partnerNodeId bigint 19  √  null
nodelevelcapacitymapping partnerNodeName varchar 255 Textual name
authorizationunit passwordHash varchar 64  √  null
authorizationunit passwordResetTokenExpirationDate timestamp 19  √  null
authorizationunit passwordResetTokenHash varchar 64  √  null
authorizationunit passwordResetTokenSalt varchar 8  √  null
authorizationunit passwordSalt varchar 8  √  null
cifssharelivelistdtoview path varchar 255  √  null
internodeconnection peercluster_id bigint 19
interswitchconnection peercluster_id bigint 19
metroclusterrelationship peerCluster_id bigint 19  √  null
nodestackconnection peercluster_id bigint 19  √  null
nodeswitchlink peerType varchar 64  √  null
ontapfaultinfo perceivedSeverity varchar 1023  √  null
disklivelistdtoview percentRatedLifeUsed int 10  √  null An estimate of the percentage of device life that has been used
aggregate performanceRiskLevel int 10 0
cluster performanceRiskLevel int 10 0
vserver performanceRiskLevel int 10 0
aggregatehistorymonth periodEndTime timestamp 19 CURRENT_TIMESTAMP
aggregatehistoryweek periodEndTime timestamp 19 CURRENT_TIMESTAMP
aggregatehistoryyear periodEndTime timestamp 19 CURRENT_TIMESTAMP
clusterhistorymonth periodEndTime timestamp 19 CURRENT_TIMESTAMP
clusterhistoryweek periodEndTime timestamp 19 CURRENT_TIMESTAMP
clusterhistoryyear periodEndTime timestamp 19 CURRENT_TIMESTAMP
clusternodehistorymonth periodEndTime timestamp 19 CURRENT_TIMESTAMP
clusternodehistoryweek periodEndTime timestamp 19 CURRENT_TIMESTAMP
clusternodehistoryyear periodEndTime timestamp 19 CURRENT_TIMESTAMP
externalcachehistorymonth periodEndTime timestamp 19 CURRENT_TIMESTAMP
externalcachehistoryweek periodEndTime timestamp 19 CURRENT_TIMESTAMP
externalcachehistoryyear periodEndTime timestamp 19 CURRENT_TIMESTAMP
infinitevolhistorymonth periodEndTime timestamp 19 CURRENT_TIMESTAMP
infinitevolhistoryweek periodEndTime timestamp 19 CURRENT_TIMESTAMP
infinitevolhistoryyear periodEndTime timestamp 19 CURRENT_TIMESTAMP
volumehistorymonth periodEndTime timestamp 19 CURRENT_TIMESTAMP
volumehistoryweek periodEndTime timestamp 19 CURRENT_TIMESTAMP
volumehistoryyear periodEndTime timestamp 19 CURRENT_TIMESTAMP
vserverhistorymonth periodEndTime timestamp 19 CURRENT_TIMESTAMP
vserverhistoryweek periodEndTime timestamp 19 CURRENT_TIMESTAMP
vserverhistoryyear periodEndTime timestamp 19 CURRENT_TIMESTAMP
datasource pingable bit 1 b'1'
ldapserver port int 10  √  null
igrouplivelistdtoview portSetName varchar 255  √  null Textual name
lifcountperigrouplistdtoview portSetName varchar 255 Textual name
logicalinterfacelivelistdtoview portsetNames text 65535  √  null
portsetnamesperlogicalinterfacedtoview portSetNames text 65535  √  null
portlivelistdtoview portType varchar 255  √  null
ontapfaultinfo possibleEffect varchar 1023  √  null
storagearray prefix varchar 16  √  null
qrtz_triggers PREV_FIRE_TIME bigint 19  √  null
networkport previousLinkStatus varchar 255  √  null
fcptarget previousState varchar 255  √  null
clusterlivelistdtoview primaryHostName varchar 255  √  null Address used to acquire information about this cluster
groupaction priority int 10
groupactionlivelistdtoview priority int 10
qrtz_fired_triggers PRIORITY int 10
qrtz_triggers PRIORITY int 10  √  null
task priority varchar 32
taskreportview priority varchar 32
ontapfaultinfo probableCause varchar 511  √  null
ontapfaultinfo probableCauseDescription varchar 1023  √  null
databaseproperty propertyKey varchar 255
persistentproperty propertyKey varchar 255
databaseproperty propertyValue varchar 255  √  null
persistentproperty propertyValue longtext 2147483647  √  null
aggregate protectionRiskLevel int 10
cluster protectionRiskLevel int 10
vserver protectionRiskLevel int 10
volumecapacityutilizationview protectionRole varchar 14
volumecapacityview protectionRole varchar 14
volumelivelistdtoview protectionRole varchar 13
lun qtree_id bigint 19  √  null
namespace qtree_id bigint 19  √  null
userquota qtree_id bigint 19  √  null
cifssharelivelistdtoview qtreeHealthStatus int 10  √  null
lunlivelistdtoview qtreeHealthStatus int 10  √  null
nfsexportlivelistdtoview qtreeHealthStatus binary 0  √  null
userquotalivelistdtoview qtreeHealthStatus int 10  √  null
cifssharelivelistdtoview qtreeId bigint 19  √  null Locally unique object identifier. ZAPIs: qtree-list-iter.qtree-info
lunlivelistdtoview qtreeId bigint 19  √  null Locally unique object identifier. ZAPIs: qtree-list-iter.qtree-info
nfsexportlivelistdtoview qtreeId bigint 19  √  null
nfsexportreportview qtreeId bigint 19  √  null
qtreecapacityutilizationreportview qtreeId bigint 19  √  null
qtreelivelistdtoview qtreeId bigint 19  √  null Reference to the qtree to which this quota applies
userquotalivelistdtoview qtreeId bigint 19  √  null
cifssharelivelistdtoview qtreeName varchar 255  √  null
lunlivelistdtoview qtreeName varchar 255  √  null
nfsexportlivelistdtoview qtreeName varchar 255  √  null
nfsexportreportview qtreeName varchar 255  √  null
qtreecapacityutilizationreportview qtreeName varchar 255  √  null
userquotalivelistdtoview qtreeName varchar 255  √  null
userquotalivelistdtoview quota varchar 1024  √  null
qtree quota_id bigint 19  √  null
volumecapacityutilizationview quotaCommittedCapacity decimal 10,2  √  null
volumecapacityview quotaCommittedCapacity decimal 10,2  √  null
qtreecapacityutilizationreportview quotaId bigint 19  √  null
volumecapacityutilizationview quotaOverCommittedCapacity decimal 10,2  √  null
volumecapacityview quotaOverCommittedCapacity decimal 10,2  √  null
userquotalivelistdtoview quotaSource varchar 255  √  null
qtreecapacityutilizationreportview quotaType varchar 10  √  null
userquotalivelistdtoview quotaType enum 10  √  null Type of quota
qtreecapacityutilizationreportview quotaUserName text 65535  √  null
disklivelistdtoview raidGroupName varchar 255  √  null Textual name
disklivelistdtoview raidState varchar 40  √  null
wafldisk raidState varchar 40  √  null
aggregatelivelistdtoview raidStatus varchar 255  √  null RAID status as string
aggregatecapacityutilizationview raidtype varchar 15  √  null
aggregatelivelistdtoview raidType varchar 255  √  null
disklivelistdtoview raidType varchar 255  √  null
annotationrule rank int 10
annotationrulelivelistdtoview rank int 10
clusternodededicatesparecapacityview rawBytesDedicatedSpare decimal 41  √  null
clusternodelivelistdtoview rawBytesDedicatedSpare decimal 41  √  null
clusternodelivelistdtoview rawBytesSharedCacheSpare decimal 41  √  null
clusternoderawsparesharedcachecapacityview rawBytesSharedCacheSpare decimal 41  √  null
clusternodelivelistdtoview rawBytesSharedDataSpare decimal 42  √  null
clusternoderawspareshareddatacapacityview rawBytesSharedDataSpare decimal 42  √  null
clusternodelivelistdtoview rawBytesSpare decimal 65  √  null
clusternoderawsparecapacityview rawBytesSpare decimal 65  √  null
clusternodelivelistdtoview rawBytesTotal bigint 19  √  null DERIVED.Sum of all disks size total
clusterhistorymonth rawBytesTotalSum decimal 22 0
clusterhistoryweek rawBytesTotalSum decimal 22 0
clusterhistoryyear rawBytesTotalSum decimal 22 0
clusternodehistorymonth rawBytesTotalSum decimal 24 0
clusternodehistoryweek rawBytesTotalSum decimal 24 0
clusternodehistoryyear rawBytesTotalSum decimal 24 0
clusternodelivelistdtoview rawBytesUsed bigint 19  √  null DERIVED.Sum of all disks size used
clusterhistorymonth rawBytesUsedSum decimal 24 0
clusterhistoryweek rawBytesUsedSum decimal 24 0
clusterhistoryyear rawBytesUsedSum decimal 24 0
clusternodehistorymonth rawBytesUsedSum decimal 24 0
clusternodehistoryweek rawBytesUsedSum decimal 24 0
clusternodehistoryyear rawBytesUsedSum decimal 24 0
storagesummary rawCapacity decimal 10,3  √  null
halevelmapping rawDiskBytesTotal decimal 41  √  null
nodelevelcapacitymapping rawDiskBytesTotal bigint 19  √  null DERIVED.Sum of all disks size total
externalcache readRequestsPerSecond bigint 19  √  null
externalcachehistorymonth readRequestsPerSecondSum bigint 19 0
externalcachehistoryweek readRequestsPerSecondSum bigint 19 0
externalcachehistoryyear readRequestsPerSecondSum bigint 19 0
ontapems recievedTimestamp timestamp 19 CURRENT_TIMESTAMP
inventoryscheduleview recipients varchar 255
inventoryviewschedule recipients varchar 255
storageserviceconnectionmember relationship_id bigint 19  √  null
volumedatatransferstatusview relationshipId bigint 19 Locally unique object identifier. ZAPIs: snapmirror-get-iter.snapmirror-info
svmrelationshiplivelistdtoview relationshipState varchar 255  √  null Raw mirror state enum value
volumerelationshiplivelistdtoview relationshipState varchar 255  √  null Raw mirror state enum value
svmrelationshiplivelistdtoview relationshipStatus varchar 255  √  null Raw relationship status enum value
volumerelationshiplivelistdtoview relationshipStatus varchar 255  √  null Raw relationship status enum value
volumerelationshiplivelistdtoview relationshipType varchar 255  √  null Raw relationship status enum value
qrtz_simple_triggers REPEAT_COUNT bigint 19
qrtz_simple_triggers REPEAT_INTERVAL bigint 19
alert repeatDuration bigint 19  √  null
task reportable bit 1
taskreportview reportable bit 1
inventoryviewreport reportExportCount int 10 0
inventoryviewreport reportName varchar 255
inventoryviewreport reportObjectType varchar 255
inventoryviewreport reportTimeRangeInHours int 10  √  null
inventoryviewreport reportType varchar 255  √  CSV
qrtz_fired_triggers REQUESTS_RECOVERY varchar 1  √  null
qrtz_job_details REQUESTS_RECOVERY varchar 1
event resolvedBy varchar 128  √  null
event resolvedTimestamp timestamp 19  √  null
annotationresourceobject resource_id bigint 19
annotationresourceobject resource_type varchar 100
logicalinterface resource_type varchar 40
annotationmanualresourcemapping resourceId bigint 19
annotationresourceobjectlivelistdtoview resourceId bigint 19
deferredmccresource resourceId bigint 19
groupmembership resourceId bigint 19
maintenance_window_object_mapping resourceId bigint 19
aggregatecapacityutilizationview resourcekey varchar 512
bridge resourceKey varchar 512
bridgestackconnection resourceKey varchar 512
bridgestacklink resourceKey varchar 512
clusterunconfiguredcapacitymapping resourceKey varchar 512
datasource resourceKey varchar 512
favorite resourceKey varchar 512
internodeconnection resourceKey varchar 512
internodelink resourceKey varchar 512
interswitchconnection resourceKey varchar 512
interswitchlink resourceKey varchar 512
managementstation resourceKey varchar 512
metroclusterrelationship resourceKey varchar 512
nodebridgeconnection resourceKey varchar 512
nodebridgelink resourceKey varchar 512
nodestackconnection resourceKey varchar 512
nodestacklink resourceKey varchar 512
nodeswitchconnection resourceKey varchar 512
nodeswitchlink resourceKey varchar 512
ontapfaultinfo resourceKey varchar 512
resourcepool resourceKey varchar 512
resourcepoollivelistdtoview resourceKey varchar 512
serviceworkflow resourceKey varchar 512
storageservice resourceKey varchar 512
storageserviceconnection resourceKey varchar 512
storageservicenode resourceKey varchar 512
storageservicesubscription resourceKey varchar 512
storagesummary resourceKey varchar 512
switch resourceKey varchar 512
switchbridgeconnection resourceKey varchar 512
switchbridgelink resourceKey varchar 512
volumecapacityutilizationview resourceKey varchar 255  √  null
volumecapacityview resourceKey varchar 255  √  null
annotationresourceobjectlivelistdtoview resourceName varchar 255  √  null
alertresourceobjects resourceObject_id bigint 19
favorite resourceObject_id bigint 19
alertresourceobjects resourceObject_type varchar 100
favorite resourceObject_type varchar 50
resourcepoolaggregates resourcePool_id bigint 19
storageservicenoderesourcepool resourcePool_id bigint 19
aggregatelivelistdtoview resourcePoolId bigint 19  √  null
annotationmanualresourcemapping resourceType varchar 100
annotationresourceobjectlivelistdtoview resourceType varchar 100
annotationrule resourceType varchar 255
annotationrulelivelistdtoview resourceType varchar 255
deferredmccresource resourceType varchar 40
maintenance_window_object_mapping resourceType varchar 40
alert resourceTypes longtext 2147483647  √  null
aggregatelivelistdtoview resyncPercent decimal 32  √  null
logicalinterfacelivelistdtoview role varchar 255  √  null
portlivelistdtoview role varchar 255  √  null
switch role varchar 20  √  null
wafldisk role varchar 40  √  null
authorizationunit role_id bigint 19
storageserviceconnectionmember rootMemberInfo_id bigint 19
storageservicenodemember rootMemberInfo_id bigint 19
storageservicesubscriptionrootmember rootMemberInfo_id bigint 19
storageservicerootmemberinfo rootNodeMember_id bigint 19  √  null
vserverlivelistdtoview rootVolumeHealthStatus int 10  √  null
vserverlivelistdtoview rootVolumeId bigint 19  √  null Locally unique object identifier. ZAPIs: volume-get-iter.volume-attributes
vserverlivelistdtoview rootVolumeName varchar 255  √  null Textual name
exportrulelivelistdtoview roRule varchar 255  √  null Rule for read-only access. Ordered, comma separated list of the array values in ONTAP.
routinggrouproutesview route varchar 255  √  null The IP address and subnet mask of destination
logicalinterfacelivelistdtoview routingGroupId bigint 19  √  null
routinggrouproutesview routingGroupId bigint 19  √  null
logicalinterfacelivelistdtoview routingGroupName varchar 255  √  null
disklivelistdtoview rpm int 10  √  null Disk RPM
nfsexportreportview ruleAccessProtocol varchar 255 Client access protocol. Default value is 'any'. May be comma separated
nfsexportreportview ruleClientMatch varchar 255 Client match specification for Export rule. The clients specified are enforced with this Export rule. The rule with the higher rule index value takes precedence
exportrulelivelistdtoview ruleIndex int 10  √  null Export rule index
nfsexportreportview ruleIndex int 10  √  null Export rule index
nfsexportreportview ruleRoRule varchar 255  √  null Rule for read-only access. Ordered, comma separated list of the array values in ONTAP.
nfsexportreportview ruleRwRule varchar 255  √  null Rule for read-write access. Ordered, comma separated list of the array values in ONTAP.
selectioncriterion ruleType varchar 32
readytaskworkitemqueueentry running bit 1
exportrulelivelistdtoview rwRule varchar 255  √  null Rule for read-write access. Ordered, comma separated list of the array values in ONTAP.
aggregatehistorymonth sampleCount int 10 1
aggregatehistoryweek sampleCount int 10 1
aggregatehistoryyear sampleCount int 10 1
clusterhistorymonth sampleCount int 10 1
clusterhistoryweek sampleCount int 10 1
clusterhistoryyear sampleCount int 10 1
clusternodehistorymonth sampleCount int 10 1
clusternodehistoryweek sampleCount int 10 1
clusternodehistoryyear sampleCount int 10 1
externalcachehistorymonth sampleCount int 10 1
externalcachehistoryweek sampleCount int 10 1
externalcachehistoryyear sampleCount int 10 1
infinitevolhistorymonth sampleCount int 10 1
infinitevolhistoryweek sampleCount int 10 1
infinitevolhistoryyear sampleCount int 10 1
volumehistorymonth sampleCount int 10 1
volumehistoryweek sampleCount int 10 1
volumehistoryyear sampleCount int 10 1
vserverhistorymonth sampleCount int 10 1
vserverhistoryweek sampleCount int 10 1
vserverhistoryyear sampleCount int 10 1
qrtz_blob_triggers SCHED_NAME varchar 120 unifiedManagerScheduler
qrtz_calendars SCHED_NAME varchar 120 unifiedManagerScheduler
qrtz_cron_triggers SCHED_NAME varchar 120 unifiedManagerScheduler
qrtz_fired_triggers SCHED_NAME varchar 120 unifiedManagerScheduler
qrtz_job_details SCHED_NAME varchar 120 unifiedManagerScheduler
qrtz_locks SCHED_NAME varchar 120 unifiedManagerScheduler
qrtz_paused_trigger_grps SCHED_NAME varchar 120 unifiedManagerScheduler
qrtz_scheduler_state SCHED_NAME varchar 120 unifiedManagerScheduler
qrtz_simple_triggers SCHED_NAME varchar 120 unifiedManagerScheduler
qrtz_simprop_triggers SCHED_NAME varchar 120
qrtz_triggers SCHED_NAME varchar 120 unifiedManagerScheduler
qrtz_fired_triggers SCHED_TIME bigint 19
svmrelationshiplivelistdtoview scheduleId bigint 19  √  null
volumerelationshiplivelistdtoview scheduleId bigint 19  √  null
svmrelationshiplivelistdtoview scheduleName varchar 255  √  null The name of the job schedule. ZAPIs: job-schedule-iter job-schedule-info job-schedule-name
volumerelationshiplivelistdtoview scheduleName varchar 255  √  null
alert scriptId bigint 19  √  null
alert_script_audit scriptName varchar 255  √  null
inventoryview search varchar 255  √  null
internodeconnection secondNode_id bigint 19  √  null
internodelink secondNodePort varchar 255  √  null
internodelink secondNodePortWWPN varchar 255  √  null
interswitchconnection secondSwitch_id bigint 19  √  null
interswitchlink secondSwitchPort varchar 255  √  null
interswitchlink secondSwitchPortWWPN varchar 255  √  null
nfsexportlivelistdtoview securityPermission varchar 255  √  null Unix permission bits in octal string format
nfsexportreportview securityPermission varchar 256  √  null
cifssharelivelistdtoview securityStyle varchar 256  √  null
nfsexportlivelistdtoview securityStyle varchar 255  √  null
nfsexportreportview securityStyle varchar 255  √  null
conditiongroup selectionCriterionId bigint 19
alert sendSnmpTrap bit 1
hibernate_sequences sequence_name varchar 60
bridge serialNumber varchar 255  √  null
clusterlivelistdtoview serialNumber varchar 255  √  null Serial number
clusternodelivelistdtoview serialNumber varchar 255  √  null Serial number
lunlivelistdtoview serialNumber varchar 255  √  null Serial number of the LUN
nodelevelcapacitymapping serialNumber varchar 255  √  null Serial number
storagearray serialNumber varchar 64
storageservicenode serviceWorkflow_id bigint 19  √  null
eventtypevalue severity int 10
trap severity varchar 16
disklivelistdtoview shelf varchar 255  √  null Disk shelf, if it can be determined
bridgestacklink shelfPort varchar 255  √  null
nodestacklink shelfPort varchar 255  √  null
bridgestacklink shelfPortWWPN varchar 255  √  null
nodestacklink shelfPortWWPN varchar 255  √  null
clusterlivelistdtoview shortOSVersion varchar 1024  √  null
clusternodelivelistdtoview shortOSVersion varchar 1024  √  null
backupfileinfo size bigint 19  √  null
externalcache sizeInGB bigint 19  √  null
externalcachehistorymonth sizeInGBSum bigint 19 0
externalcachehistoryweek sizeInGBSum bigint 19 0
externalcachehistoryyear sizeInGBSum bigint 19 0
volumecapacityutilizationview snapLockExpiryDate varchar 64  √  null
volumecapacityview snapLockExpiryDate varchar 64  √  null
aggregatecapacityutilizationview snapLockType varchar 255  √  null
aggregatelivelistdtoview snapLockType varchar 255  √  null
resourcepool snapLockType longtext 2147483647  √  null
resourcepoollivelistdtoview snapLockType longtext 2147483647  √  null
volumecapacityutilizationview snapLockType varchar 255  √  null
volumecapacityview snapLockType varchar 255  √  null
volumelivelistdtoview snapLockType varchar 255  √  null
svmrelationshiplivelistdtoview snapMirrorPolicyId bigint 19  √  null
volumerelationshiplivelistdtoview snapMirrorPolicyId bigint 19  √  null
svmrelationshiplivelistdtoview snapMirrorPolicyName varchar 255  √  null The name of the policy.
volumerelationshiplivelistdtoview snapMirrorPolicyName varchar 255  √  null The name of the policy.
volumerelationshiplivelistdtoview snapMirrorPolicyType enum 18  √  null The type of the Snapmirror policy - "vault" , "async_mirror" , "mirror_vault" ,"sync_mirror", "strict_sync_mirror"
snapmirrortransfer snapMirrorRelationshipId bigint 19  √  null
volumesnapshot_metadatafields snapshot_id bigint 19
volumecapacityutilizationview snapshotAutoDelete int 10 0
volumecapacityview snapshotAutoDelete int 10 0
aggregateregressioninfo snapshotBytesUsedPerDay double 22 0
volumeregressioninfo snapshotBytesUsedPerDay double 22 0
volumecapacityutilizationview snapshotOverflow double 19,2  √  null
volumecapacityview snapshotOverflowPercentage double 19,2  √  null
vserverlivelistdtoview snapshotPolicyHealthStatus int 10  √  null
vserverlivelistdtoview snapshotPolicyId bigint 19  √  null
vserverlivelistdtoview snapshotPolicyName varchar 255  √  null A human readable string describing the name of the snapshot scheduling policy.
volumecapacityutilizationview snapshotReserveAvailable double 19,2  √  null
volumecapacityutilizationview snapshotReserveAvailableCapacity decimal 10,2  √  null
volumecapacityview snapshotReserveAvailableCapacity decimal 10,2  √  null
volumecapacityview snapshotReserveAvailablePercentage double 19,2  √  null
aggregatecapacityutilizationview snapshotReserveAvailCapacity decimal 10,2  √  null
aggregatecapacityutilizationview snapshotReserveAvailPercentage varchar 71  √  null
managedvolumecalculationsview snapshotReserveDaysUntilFull double 22  √  null
aggregatecapacityutilizationview snapshotReserveTotalCapacity decimal 10,2  √  null
volumecapacityutilizationview snapshotReserveTotalCapacity decimal 10,2  √  null
volumecapacityview snapshotReserveTotalCapacity decimal 10,2  √  null
volumecapacityutilizationview snapshotReserveUsed double 19,2  √  null
aggregatecapacityutilizationview snapshotReserveUsedCapacity decimal 10,2  √  null
volumecapacityutilizationview snapshotReserveUsedCapacity decimal 10,2  √  null
volumecapacityview snapshotReserveUsedCapacity decimal 10,2  √  null
aggregatecapacityutilizationview snapshotReserveUsedPercentage varchar 71  √  null
volumecapacityview snapshotReserveUsedPercentage double 19,2  √  null
snapshotexpirerecord snapshotResourceKey varchar 512
snapshotmetadata snapshotResourceKey varchar 512
alert_script_audit snmpDestination varchar 45  √  null
inventoryview sort varchar 100  √  null
event source_fullName varchar 2000
event source_id bigint 19
trap source_id bigint 19  √  null
event source_resourceKey varchar 512
event source_resourceType varchar 40
event source_type varchar 100
volumerelationshiplivelistdtoview sourceAggregateHealthStatus int 10  √  null
volumerelationshiplivelistdtoview sourceAggregateId bigint 19  √  null Locally unique object identifier. ZAPIs: aggr-get-iter.aggr-attributes
volumerelationshiplivelistdtoview sourceAggregateName varchar 255  √  null Textual name
volumedatatransferstatusview sourceClusterFqdn varchar 255  √  null
volumerelationshiplivelistdtoview sourceClusterFqdn varchar 255  √  null
svmrelationshiplivelistdtoview sourceClusterHealthStatus int 10  √  null
volumerelationshiplivelistdtoview sourceClusterHealthStatus int 10  √  null
svmrelationshiplivelistdtoview sourceClusterId bigint 19  √  null Locally unique object identifier. ZAPIs: cluster-identity-get.cluster-identity-info
volumedatatransferstatusview sourceClusterId bigint 19  √  null Locally unique object identifier. ZAPIs: cluster-identity-get.cluster-identity-info
volumerelationshiplivelistdtoview sourceClusterId bigint 19  √  null Locally unique object identifier. ZAPIs: cluster-identity-get.cluster-identity-info
vserverassociationlivelistdtoview sourceClusterId bigint 19  √  null Locally unique object identifier. ZAPIs: cluster-identity-get.cluster-identity-info
svmrelationshiplivelistdtoview sourceClusterName varchar 255  √  null Textual name
volumedatatransferstatusview sourceClusterName varchar 255  √  null Textual name
volumerelationshiplivelistdtoview sourceClusterName varchar 255  √  null Textual name
vserverassociationlivelistdtoview sourceClusterName varchar 255  √  null Textual name
volumerelationshiplivelistdtoview sourceClusterNodeHealthStatus int 10  √  null
volumerelationshiplivelistdtoview sourceClusterNodeId bigint 19  √  null Locally unique object identifier. ZAPIs: system-node-get-iter.node-details-info, system-get-node-info-iter.system-info
volumerelationshiplivelistdtoview sourceClusterNodeName varchar 255  √  null Textual name
volumerelationshiplivelistdtoview sourceClusterVersion varchar 255  √  null Version of the cluster
volumerelationshiplivelistdtoview sourceClusterVersionGeneration int 10  √  null First integer of the Data ONTAP version tuple corresponding to the lowest version across the cluster
volumerelationshiplivelistdtoview sourceClusterVersionMajor int 10  √  null Second integer of the Data ONTAP version tuple corresponding to the lowest version across the cluster
volumerelationshiplivelistdtoview sourceClusterVersionMinor int 10  √  null Third integer of the Data ONTAP version tuple corresponding to the lowest version across the cluster
storageserviceconnection sourceNode_id bigint 19
volumerelationshiplivelistdtoview sourceNodeCount int 10  √  1
storageserviceconnectionmember sourceNodeMember_id bigint 19
volumerelationshiplivelistdtoview sourcePath text 65535  √  null
eventtypesourcetypes sourceType varchar 40
eventtypesourcetypes sourceTypeDisplayName varchar 255
volumerelationshiplivelistdtoview sourceVolumeHealthStatus int 10  √  null
volumedatatransferstatusview sourceVolumeId bigint 19  √  null Locally unique object identifier. ZAPIs: volume-get-iter.volume-attributes
volumeoutgoingrelationshipview sourceVolumeId bigint 19 Locally unique object identifier. ZAPIs: volume-get-iter.volume-attributes
volumerelationshiplivelistdtoview sourceVolumeId bigint 19  √  null Locally unique object identifier. ZAPIs: volume-get-iter.volume-attributes
volumedatatransferstatusview sourceVolumeName varchar 255  √  null Textual name
volumerelationshiplivelistdtoview sourceVolumeName varchar 255  √  null Textual name
volumerelationshiplivelistdtoview sourceVolumeState varchar 255  √  null
volumerelationshiplivelistdtoview sourceVolumeStyle enum 11  √  null DERIVED. Similar to ZAPI based style, but adds in constituent as necessary.
volumerelationshiplivelistdtoview sourceVolumeType varchar 255  √  null
storageservicevserverdestination sourceVserver_id bigint 19  √  null
svmrelationshiplivelistdtoview sourceVserverHealthStatus int 10  √  null
volumerelationshiplivelistdtoview sourceVserverHealthStatus int 10  √  null
svmrelationshiplivelistdtoview sourceVserverId bigint 19  √  null Locally unique object identifier. ZAPIs: vserver-get-iter.vserver-info
volumedatatransferstatusview sourceVserverId bigint 19  √  null Locally unique object identifier. ZAPIs: vserver-get-iter.vserver-info
volumerelationshiplivelistdtoview sourceVserverId bigint 19  √  null Locally unique object identifier. ZAPIs: vserver-get-iter.vserver-info
vserverassociationlivelistdtoview sourceVserverId bigint 19  √  null Locally unique object identifier. ZAPIs: vserver-get-iter.vserver-info
svmrelationshiplivelistdtoview sourceVserverName varchar 255  √  null Textual name
volumedatatransferstatusview sourceVserverName varchar 255  √  null Textual name
volumerelationshiplivelistdtoview sourceVserverName varchar 255  √  null Textual name
vserverassociationlivelistdtoview sourceVserverName varchar 255  √  null Textual name
volumecapacityutilizationview spaceGuarantee varchar 255
volumecapacityview spaceGuarantee varchar 255
clusterlivelistdtoview sslFipsEnabled bit 0  √  null Indicates whether or not SSL FIPS 140-2 is Enabled
bridgestackconnection stack_id varchar 255
nodestackconnection stack_id varchar 255
qrtz_triggers START_TIME bigint 19
task startedTimestamp timestamp 19  √  null
taskreportview startedTimestamp timestamp 19  √  null
inventoryscheduleview startTime varchar 20
inventoryviewschedule startTime varchar 20
maintenance_window startTime bigint 19
aggregatecapacityutilizationview state varchar 255
aggregatelivelistdtoview state varchar 255  √  null
event state varchar 16
jobreportview state varchar 9
portlivelistdtoview state varchar 255  √  null
qrtz_fired_triggers STATE varchar 16
snapmirrortransfer state enum 12  √  null
volumecapacityutilizationview state varchar 255
volumecapacityview state varchar 255
volumelivelistdtoview state varchar 255  √  null
vserverlivelistdtoview state varchar 255  √  null
backupfileinfo status varchar 255
job status varchar 32
jobreportview status int 10 0
logicalinterfacelivelistdtoview status varchar 255  √  null
qtreecapacityutilizationreportview status varchar 12  √  null
subscribedems status varchar 30  √  null
switch status varchar 255  √  null
task status varchar 32
taskreportview status int 10  √  null
taskstatuschange status varchar 32
taskstatuschangeview status int 10  √  null
storagearrayclusterassociation storageArray_id bigint 19
storagearrayport storageArray_id bigint 19
storagearraylunpath storageArrayLUN_id bigint 19  √  null
storagearraylunpath storageArrayPort_id bigint 19  √  null
storagearrayportclusterassociation storageArrayPort_id bigint 19
storagearraylunpath storageArrayPortWwpn varchar 64  √  null
volumelivelistdtoview storageClassName varchar 255  √  null Storage Service Name. ZAPIs: volume-storage-service-get-iter.storage-service-info.storage-service
groupmembership storageObjectType varchar 100
groupmembershiprule storageObjectType varchar 255
groupmembershiprulelivelistdtoview storageObjectType varchar 255
aggregatestoragepoollivelistdtoview storagePoolHealthStatus int 10 0
disklivelistdtoview storagePoolHealthStatus int 10  √  null
aggregatestoragepoollivelistdtoview storagePoolid bigint 19 Locally unique object identifier. ZAPI: storage-pool-get-iter.storage-pool-info
disklivelistdtoview storagePoolId bigint 19  √  null Locally unique object identifier. ZAPI: storage-pool-get-iter.storage-pool-info
aggregatestoragepoollivelistdtoview storagePoolName varchar 255 The cluster-wide unique name of the storage pool.
disklivelistdtoview storagePoolName varchar 255  √  null The cluster-wide unique name of the storage pool.
storageservice_contacts storageService_id bigint 19
storageserviceconnection storageService_id bigint 19
storageservicenode storageService_id bigint 19
storageservicerootmemberinfo storageService_id bigint 19
storageservicesubscription storageService_id bigint 19
volumerelationshiplivelistdtoview storageServiceName varchar 255  √  null Storage Service Name. ZAPIs: volume-storage-service-get-iter.storage-service-info.storage-service
storageservicenoderesourcepool storageServiceNode_id bigint 19
storageservicesubscription_metadatafields StorageServiceSubscription_id bigint 19
qrtz_simprop_triggers STR_PROP_1 varchar 512  √  null
qrtz_simprop_triggers STR_PROP_2 varchar 512  √  null
qrtz_simprop_triggers STR_PROP_3 varchar 512  √  null
inventoryview style enum 7
volumelivelistdtoview styleExtended varchar 255  √  null Identifies license type
volumeaggregatecapacitymappingview styleExtendedRaw varchar 255  √  null
volumeaggregatemappingview styleExtendedRaw varchar 255  √  null
job submittedTimestamp timestamp 19 CURRENT_TIMESTAMP
jobreportview submittedTimestamp timestamp 19 0000-00-00 00:00:00
storageservicesubscriptionrootmember subscription_id bigint 19
event subType smallint 5  √  null
vserverlivelistdtoview subType enum 16  √  null Subtype of Vserver.
aggregategrowthrateinfo sumOfSquaresOfDifferencesFromMean double 22 0
volumegrowthrateinfo sumOfSquaresOfDifferencesFromMean double 22 0
aggregateregressioninfo sumProductOfTimeAndBytesData double 22 0
volumeregressioninfo sumProductOfTimeAndBytesData double 22 0
aggregateregressioninfo sumProductOfTimeAndSnapshotData double 22 0
volumeregressioninfo sumProductOfTimeAndSnapshotData double 22 0
aggregateregressioninfo sumTimeSquared double 22 0
volumeregressioninfo sumTimeSquared double 22 0
volumecapacityview svm varchar 255  √  null
clusternodelivelistdtoview svmCount bigint 19  √  null
volumecapacityview svmId bigint 19
nodeswitchconnection switch_id bigint 19  √  null
switchbridgeconnection switch_id bigint 19  √  null
switchinterswitchrelationship switch_id bigint 19
switchbridgelink switchBridgeConnection_id bigint 19  √  null
storagearraylunpath switchName varchar 64  √  null
nodeswitchlink switchPort varchar 255  √  null
storagearraylunpath switchPort varchar 64  √  null
switchbridgelink switchPort varchar 255  √  null
nodeswitchlink switchPortWWPN varchar 255  √  null
switchbridgelink switchPortWWPN varchar 255  √  null
volumelivelistdtoview syncMirrorRelationshipParticipantStatus varchar 21  √  null
volume systemStorageClass_id bigint 19  √  null
event targetId bigint 19  √  null
event targetType smallint 5  √  null
task task longblob 2147483647  √  null
taskmessage task_id varchar 64
taskobjectinteraction task_id varchar 64
taskpredecessor task_id varchar 64
taskretry task_id varchar 64
taskstatuschange task_id varchar 64
task taskGuardName varchar 255
taskreportview taskGuardName varchar 255
taskstatuschangeview taskId varchar 64
taskpredecessor taskPredecessor_id varchar 64
taskreportview taskState varchar 32  √  null
taskstatuschangeview taskState varchar 32  √  null
task taskType varchar 64
taskreportview taskType varchar 64
volumecapacityutilizationview thinProvisioned int 10 0
volumecapacityview thinProvisioned int 10 0
event thresholdPolicyId bigint 19  √  null
volumecapacityutilizationview tieringPolicy varchar 255
volumecapacityview tieringPolicy varchar 255
volumelivelistdtoview tieringPolicy varchar 255  √  null Identifies assicated tiering policy for a volume
qrtz_cron_triggers TIME_ZONE_ID varchar 80  √  null
alert timeFrom bigint 19  √  null
taskretry timeRetryAt timestamp 19  √  null
qrtz_simple_triggers TIMES_TRIGGERED bigint 19
favorite timeStamp timestamp 19  √  null
taskmessage timestamp timestamp 19 CURRENT_TIMESTAMP
taskstatuschange timestamp timestamp 19 CURRENT_TIMESTAMP
taskstatuschangeview timestamp timestamp 19 0000-00-00 00:00:00
alert timeTo bigint 19  √  null
disklivelistdtoview totalBytes bigint 19  √  null DERIVED from totalBlocks * 4096 bytes/block.
storagesummary totalClusterStorageGridCapacitySpaceUsed decimal 10,3  √  null
aggregatecapacityutilizationview totalCommitted decimal 10,2  √  null
aggregatecapacityutilizationview totalDataCapacity decimal 10,2  √  null
volumecapacityutilizationview totalDataCapacity decimal 10,2  √  null
volumecapacityview totalDataCapacity decimal 10,2  √  null
storagesummary totalExternalCapacityTierLicensedSpace decimal 10,3  √  null
storagesummary totalExternalCapacityTierLicensedSpaceUsed decimal 10,3  √  null
switch totalFanCount int 10  √  null
volumecapacityutilizationview totalNumberOfInodes bigint 19  √  null Total user-visible file (inode) count, i.e., current maximum number of user-visible files (inodes) that this volume can currently hold. ZAPIs: volume-get-iter volume-inode-attributes files-total
volumecapacityview totalNumberOfInodes bigint 19  √  null Total user-visible file (inode) count, i.e., current maximum number of user-visible files (inodes) that this volume can currently hold. ZAPIs: volume-get-iter volume-inode-attributes files-total
switch totalpowerSupplyCount int 10  √  null
aggregatelivelistdtoview totalStorageEfficiencyRatio varchar 20  √  null Indicates the total storage efficiency ratio of an aggregate
bridge totalTemperatureSensorCount int 10  √  null
switch totalTemperatureSensorCount int 10  √  null
volumetransferrateweeklyview totalTransferSize decimal 46,3  √  null
halevelmapping totalVolumeCapacity decimal 63  √  null
nodelevelcapacitymapping totalVolumeCapacity decimal 41  √  null
volumenodecapacitymapping totalVolumeCapacity decimal 41  √  null
clusterunconfiguredcapacitymapping TotExternalCapacityTierLicensedSpaceUsed decimal 41  √  null
clusterunconfiguredcapacitymapping TotExternalCapacityTierUnLicensedSpaceUsed decimal 41  √  null
clusterunconfiguredcapacitymapping TotExternalCapaityTierLicensedSpace bigint 19  √  null
snapmirrortransfer transferDuration bigint 19  √  null
volumedatatransferstatusview transferDuration decimal 24,3  √  null
volumedatatransferstatusview transferEndTime datetime 19  √  null
snapmirrortransfer transferError varchar 1024  √  null
volumerelationshiplivelistdtoview transferPriority varchar 255  √  null
volumedatatransferstatusview transferSize decimal 23,3  √  null
volumedatatransferstatusview transferStartTime datetime 19  √  null
trapvarbinding trap_id bigint 19  √  null
trap trapTimestamp timestamp 19  √  null
trap trapType varchar 32
qrtz_blob_triggers TRIGGER_GROUP varchar 200
qrtz_cron_triggers TRIGGER_GROUP varchar 200
qrtz_fired_triggers TRIGGER_GROUP varchar 200
qrtz_paused_trigger_grps TRIGGER_GROUP varchar 200
qrtz_simple_triggers TRIGGER_GROUP varchar 200
qrtz_simprop_triggers TRIGGER_GROUP varchar 200
qrtz_triggers TRIGGER_GROUP varchar 200
qrtz_blob_triggers TRIGGER_NAME varchar 200
qrtz_cron_triggers TRIGGER_NAME varchar 200
qrtz_fired_triggers TRIGGER_NAME varchar 200
qrtz_simple_triggers TRIGGER_NAME varchar 200
qrtz_simprop_triggers TRIGGER_NAME varchar 200
qrtz_triggers TRIGGER_NAME varchar 200
qrtz_triggers TRIGGER_STATE varchar 16
qrtz_triggers TRIGGER_TYPE varchar 8
alert_script_audit triggerTimestamp timestamp 19 CURRENT_TIMESTAMP
serviceworkflow type varchar 64
annotation type_id bigint 19
eventtypevalue type_id bigint 19
storagesummary unallocatedLunCapacity decimal 10,3  √  null
halevelmapping unassignedLunCapacity decimal 65  √  null
lunnodecapacitymapping unassignedLunCapacity decimal 41  √  null
nodelevelcapacitymapping unassignedLunCapacity decimal 63  √  null
cifssharelivelistdtoview unAvailableParentVolumeId bigint 19  √  null
nfsexportlivelistdtoview unAvailableParentVolumeId bigint 19  √  null
volume unAvailableParentVolumeId bigint 19  √  null
clusterunconfiguredcapacitymapping unconfiguredRawCapacity decimal 60  √  null
diskcapacitymapping unconfiguredRawCapacity decimal 60  √  null
storagesummary unconfiguredRawCapacity decimal 10,3  √  null
volumerelationshiplivelistdtoview unhealthyReason varchar 255  √  null The reason the relationship is not healthy
eventtypevalue uniqueName varchar 255
customeventtypevalue unqualifiedPrettyName varchar 255
externalcache usagePercentage int 10  √  null
externalcachehistorymonth usagePercentageSum bigint 19 0
externalcachehistoryweek usagePercentageSum bigint 19 0
externalcachehistoryyear usagePercentageSum bigint 19 0
disklivelistdtoview usedBytes bigint 19  √  null DERIVED from usedBlocks * 4096 bytes/block.
volumecapacityutilizationview usedData decimal 25,2  √  null
aggregatecapacityutilizationview usedDataCapacity decimal 10,2  √  null
volumecapacityutilizationview usedDataCapacity decimal 10,2  √  null
volumecapacityview usedDataCapacity decimal 10,2  √  null
aggregatecapacityutilizationview usedDataCapacityPercentage decimal 25,2  √  null
volumecapacityview usedDataPercentage decimal 25,2  √  null
aggregatecapacityutilizationview usedExternalCapacityTierSpace decimal 10,2  √  null
aggregatelivelistdtoview usedExternalTierCapacity bigint 19  √  null
license uuid varchar 50  √  null
ontapfaultinfo uuid varchar 255  √  null
serviceworkflow uuid varchar 64
conditiontable value varchar 255
customer_usage value varchar 45  √  null
event value_id bigint 19
trapvarbinding varValue varchar 1024  √  null
bridge vendor varchar 20  √  null
storagearray vendor varchar 255
switch vendor varchar 20  √  null
disklivelistdtoview vendorName varchar 255  √  null Disk vendor
clusternodelivelistdtoview version varchar 255  √  null Version of the cluster
volumerelationshiplivelistdtoview versionFlexibleReplication enum 15 none
aggregatelivelistdtoview versionGeneration int 10  √  null First integer of the Data ONTAP version tuple corresponding to the lowest version across the cluster
clusternodelivelistdtoview versionGeneration int 10  √  null First integer of the Data ONTAP version tuple corresponding to this Node.
vserverlivelistdtoview versionGeneration int 10  √  null First integer of the Data ONTAP version tuple corresponding to the lowest version across the cluster
aggregatelivelistdtoview versionMajor int 10  √  null Second integer of the Data ONTAP version tuple corresponding to the lowest version across the cluster
clusternodelivelistdtoview versionMajor int 10  √  null Second integer of the Data ONTAP version tuple corresponding to this Node
vserverlivelistdtoview versionMajor int 10  √  null Second integer of the Data ONTAP version tuple corresponding to the lowest version across the cluster
aggregatelivelistdtoview versionMinor int 10  √  null Third integer of the Data ONTAP version tuple corresponding to the lowest version across the cluster
clusternodelivelistdtoview versionMinor int 10  √  null Third integer of the Data ONTAP version tuple corresponding to this Node
vserverlivelistdtoview versionMinor int 10  √  null Third integer of the Data ONTAP version tuple corresponding to the lowest version across the cluster
inventoryscheduleview viewId bigint 19 0
inventoryviewschedule viewId bigint 19
inventoryscheduleview viewName varchar 255
inventoryscheduleview viewStyle enum 7
inventoryscheduleview viewType enum 28
volumelivelistdtoview volStyle enum 11  √  null DERIVED. Similar to ZAPI based style, but adds in constituent as necessary.
volumelivelistdtoview volType varchar 255  √  null
volumecapacityview volume varchar 255 Textual name
storageservicenodemember volume_id bigint 19  √  null
volumegrowthrateinfo volume_id bigint 19
volumejunctionpathhistory volume_id bigint 19
volumeregressioninfo volume_id bigint 19
vserver volumeBytesAvail double 22  √  null
vserver volumeBytesTotal double 22  √  null
vserver volumeBytesUsed double 22  √  null
storagesummary volumeCapacity decimal 10,3  √  null
annotationvaluebreakdownlivelistdtoview volumecount decimal 23  √  null
manualannotationbreakdownlivelistdto volumecount decimal 23  √  null
vserverlivelistdtoview volumeCount bigint 19  √  null
cifssharelivelistdtoview volumeHealthStatus int 10
lunlivelistdtoview volumeHealthStatus int 10
nfsexportlivelistdtoview volumeHealthStatus int 10
qtreelivelistdtoview volumeHealthStatus int 10
userquotalivelistdtoview volumeHealthStatus int 10
cifssharelivelistdtoview volumeId bigint 19 Locally unique object identifier. ZAPIs: volume-get-iter.volume-attributes
flexvolcalculationsview volumeId bigint 19 Locally unique object identifier. ZAPIs: volume-get-iter.volume-attributes
infinitevolhistorymonth volumeId bigint 19
infinitevolhistoryweek volumeId bigint 19
infinitevolhistoryyear volumeId bigint 19
lunlivelistdtoview volumeId bigint 19 Locally unique object identifier. ZAPIs: volume-get-iter.volume-attributes
managedvolumecalculationsview volumeId bigint 19 Locally unique object identifier. ZAPIs: volume-get-iter.volume-attributes
nfsexportlivelistdtoview volumeId bigint 19 Locally unique object identifier. ZAPIs: volume-get-iter.volume-attributes
nfsexportreportview volumeId bigint 19 Locally unique object identifier. ZAPIs: volume-get-iter.volume-attributes
qtreecapacityutilizationreportview volumeId bigint 19 0
qtreelivelistdtoview volumeId bigint 19 Locally unique object identifier. ZAPIs: volume-get-iter.volume-attributes
userquotalivelistdtoview volumeId bigint 19 Locally unique object identifier. ZAPIs: volume-get-iter.volume-attributes
volumeaggregatecapacitymappingview volumeId bigint 19  √  null
volumeaggregatemappingview volumeId bigint 19  √  null
volumecalculationsview volumeId bigint 19 Locally unique object identifier. ZAPIs: volume-get-iter.volume-attributes
volumecapacityutilizationview volumeId bigint 19 Locally unique object identifier. ZAPIs: volume-get-iter.volume-attributes
volumecapacityview volumeId bigint 19 Locally unique object identifier. ZAPIs: volume-get-iter.volume-attributes
volumehistorymonth volumeId bigint 19
volumehistoryweek volumeId bigint 19
volumehistoryyear volumeId bigint 19
volumelivelistmaxvolumemovejobview volumeId bigint 19
cifssharelivelistdtoview volumeName varchar 255 Textual name
deletedvolume volumeName varchar 255
lunlivelistdtoview volumeName varchar 255 Textual name
nfsexportlivelistdtoview volumeName varchar 255 Textual name
nfsexportreportview volumeName varchar 255 Textual name
qtreecapacityutilizationreportview volumeName varchar 255
qtreelivelistdtoview volumeName varchar 255 Textual name
userquotalivelistdtoview volumeName varchar 255 Textual name
volumecapacityutilizationview volumeName varchar 255 Textual name
halevelmapping volumeProtectionCapacity decimal 63  √  null
nodelevelcapacitymapping volumeProtectionCapacity decimal 41  √  null
storagesummary volumeProtectionCapacity decimal 10,3  √  null
volumenodecapacitymapping volumeProtectionCapacity decimal 41  √  null
cifssharelivelistdtoview volumeState varchar 255  √  null
nfsexportlivelistdtoview volumeState varchar 255  √  null
nfsexportreportview volumeState varchar 255  √  null
halevelmapping volumeUsedCapacity decimal 64  √  null
nodelevelcapacitymapping volumeUsedCapacity decimal 42  √  null
storagesummary volumeUsedCapacity decimal 10,3  √  null
volumenodecapacitymapping volumeUsedCapacity decimal 42  √  null
deletedvolume volumeUUID varchar 36  √  null
datapolicy vserver_id bigint 19
event vserver_id bigint 19  √  null
annotationvaluebreakdownlivelistdtoview vservercount decimal 23  √  null
manualannotationbreakdownlivelistdto vservercount decimal 23  √  null
cifssharelivelistdtoview vserverHealthStatus int 10
exportrulelivelistdtoview vserverHealthStatus int 10
igrouplivelistdtoview vserverHealthStatus int 10
initiatordtoviewlist vserverHealthStatus int 10
lunlivelistdtoview vserverHealthStatus int 10
nfsexportlivelistdtoview vserverHealthStatus int 10
qtreelivelistdtoview vserverHealthStatus int 10
userquotalivelistdtoview vserverHealthStatus int 10
volumelivelistdtoview vserverHealthStatus int 10
cifssharelivelistdtoview vserverId bigint 19
exportrulelivelistdtoview vserverId bigint 19 Locally unique object identifier. ZAPIs: vserver-get-iter.vserver-info
igrouplivelistdtoview vserverId bigint 19 Locally unique object identifier. ZAPIs: vserver-get-iter.vserver-info
initiatordtoviewlist vserverId bigint 19 Locally unique object identifier. ZAPIs: vserver-get-iter.vserver-info
lunlivelistdtoview vserverId bigint 19 Locally unique object identifier. ZAPIs: vserver-get-iter.vserver-info
nfsexportlivelistdtoview vserverId bigint 19 Locally unique object identifier. ZAPIs: vserver-get-iter.vserver-info
nfsexportreportview vserverId bigint 19 Locally unique object identifier. ZAPIs: vserver-get-iter.vserver-info
qtreecapacityutilizationreportview vserverId bigint 19 0
qtreelivelistdtoview vserverId bigint 19 Locally unique object identifier. ZAPIs: vserver-get-iter.vserver-info
userquotalivelistdtoview vserverId bigint 19 Locally unique object identifier. ZAPIs: vserver-get-iter.vserver-info
volumecapacityutilizationview vserverId bigint 19
volumelivelistdtoview vserverId bigint 19 Locally unique object identifier. ZAPIs: vserver-get-iter.vserver-info
vserverhistorymonth vserverId bigint 19
vserverhistoryweek vserverId bigint 19
vserverhistoryyear vserverId bigint 19
cifssharelivelistdtoview vserverName varchar 255 Textual name
deletedvolume vserverName varchar 255
exportrulelivelistdtoview vserverName varchar 255 Textual name
igrouplivelistdtoview vserverName varchar 255 Textual name
initiatordtoviewlist vserverName varchar 255 Textual name
lunlivelistdtoview vserverName varchar 255 Textual name
nfsexportlivelistdtoview vserverName varchar 255 Textual name
nfsexportreportview vserverName varchar 255 Textual name
qtreecapacityutilizationreportview vserverName varchar 255
qtreelivelistdtoview vserverName varchar 255 Textual name
userquotalivelistdtoview vserverName varchar 255 Textual name
volumecapacityutilizationview vserverName varchar 255  √  null
volumelivelistdtoview vserverName varchar 255 Textual name
disklivelistdtoview wearLevelPercent int 10  √  null Percentage of device spare blocks that have been used.
readytaskworkitemqueueentry workItem longblob 2147483647
readytaskworkitemqueueentry workItemId varchar 64
bridge wwn varchar 255
switch wwn varchar 255
storagearrayport wwnn varchar 64
storagearrayport wwpn varchar 64